KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2444Help
Entry
Aaci_2444         CDS       T00985                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2508195..2509184)
Genome map
AA seq 329 aa AA seqDB search
MLAFVTGGSGFVGYHVARVLVEHGHRVRALVRHPGRAPHLKALGVEMIQGDLATGDGLRA
GIDGCDAVFHVAAHYSLDPHDDALMYAANVEGTRRVLQAVREAGGPRLVYTSSTAAVKLR
HDGQPATEADGFNDPDRVVSTYKRTKVLAERLVMQAAAEGMDVVIVNPSTPVGPYDVKPT
PTGRIVLDTMLGRMPGYVETGLNLVAVEDVAIGHLLAYERGRAGERYILGNRNMHFGELV
RLIAELAGQKPPRLRIPFFAAMAYAVIDERVLAPLMKRPARAPVAGVRLAREPMYFDASK
AVRELGLPQSPVEDALLRAIEWFRSAKMA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgttcgtgaccggaggatccggctttgtgggctatcacgtcgcccgggtgctg
gtcgagcacggccaccgcgtgcgcgcgttggtgcgccatcccggccgcgccccacatctc
aaggcgctcggcgtggagatgattcaaggcgatctcgccaccggagacggtttgcgcgcc
gggatcgacggctgcgacgccgtgtttcacgtggcggcgcactactcgctcgatccgcac
gacgacgcgctgatgtacgcggccaacgtggaggggacgcgccgcgtgcttcaggcggtc
cgcgaggccggcggcccgcggctcgtctacacgagttccaccgcggcggtcaagctgaga
catgacggccagcctgcgaccgaggcggacggcttcaacgatcccgaccgcgtcgtgagc
acgtacaagcggaccaaggtgctcgccgagcgcctggtgatgcaggcggccgccgagggc
atggacgtggtcatcgtcaatccgtccacgccggtcggcccgtacgacgtgaagccgacg
ccgacgggccgcattgtgctcgacacgatgttgggcaggatgcccgggtacgtggagacg
gggctgaacctcgtggcggtggaggacgtggccatcggccacctgctcgcgtacgagcgg
gggcgcgcgggcgagcggtacattctcggcaaccggaacatgcacttcggggagttggtc
cggctcatcgcggagctcgccggacagaaacctccgcggctcaggatcccctttttcgcg
gccatggcgtacgccgtgatcgacgagcgggttctggcgccgctcatgaagcggccggcg
cgggcgccggtggccggcgtgcggcttgcgagggagccgatgtacttcgacgcgtccaag
gcggtgcgggagctcgggcttccgcagtcgccggtggaggatgcgctgcttcgcgccatc
gaatggtttcggagcgccaagatggcgtga

DBGET integrated database retrieval system