KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2483Help
Entry
Aaci_2483         CDS       T00985                                 

Definition
glycine oxidase ThiO
Orthology
K03153  
glycine oxidase [EC:1.4.3.19]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Aaci_2483
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     Aaci_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2552839..2553996)
Genome map
AA seq 385 aa AA seqDB search
MRAYDVVVVGGGAIGMASAREMARAGLSVAVIDRGRLGGEASSAAAGMLGAQLEAHAPDA
FYALCRESRAMYPSFADALFEETGIDVEWVENGILQLARSEGAALALRERMRWQRAAGDE
AVWLEPEEVRELERGVVGDVLGALYLPRDGNVHAPRLSAALRACVASACDVYEGEEVVAV
EPVGAGWRVRGAREVYAAERVVVAAGAWASPLLRALGIPLEVRPVKGQMLAVRPPRGAGL
CRTVYDAGTYLVPKRDGTVVIGATEEPDAGYDKRNTVDGLAALLAKALDAVPGLRGGEWL
RAWSGLRPRLTGDSSNPVIGPWPGAEGLILAVGHFRNGVLLAPITGRIVASAALGRAPED
LWLPFWPQTRFAARGGDVRADTLER
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcctatgacgtcgtggtggtgggcggcggcgccatcggcatggcgtcggcgcgg
gagatggcgcgcgcggggctgtccgtggccgtgatcgaccgcggtcggcttggcggggag
gcttcgagcgccgccgcggggatgctcggtgcgcagctcgaagcgcacgcgccggacgcg
ttttacgcgctgtgtcgcgagagccgggcgatgtatccgagctttgcggacgcgctcttc
gaggagacagggatcgacgtcgagtgggtggagaacgggattttgcagctcgcgcgatcc
gagggcgcggcgttggcgctcagggagcggatgcgctggcagcgcgcggctggcgatgag
gccgtttggctggagcccgaggaagtgcgcgagctcgagcgcggggttgtgggcgatgtg
ctcggcgcgctgtatctgcctcgcgacgggaacgtgcatgcgccaaggctcagcgccgcg
ctgcgggcgtgtgtggcaagcgcgtgcgacgtctacgagggcgaggaggtggtggccgtc
gagccggttggcgcgggctggcgcgtccgaggcgcgcgggaagtgtacgccgcggagcgc
gtggtcgtcgcggcgggcgcgtgggcatctcccctcctccgcgcgctcgggattccgctc
gaggtgcgcccggtgaaggggcagatgctcgccgtgcgccctccgcgcggcgcggggctt
tgccgcacggtgtacgacgccggcacgtacctggtgccaaagcgggacggaacggtcgtg
atcggcgcgacggaagagccggacgctggttatgacaagcgcaacacggtggacggcctg
gccgcgctcctggcaaaagcgctcgacgcggtgcccggccttcgcggcggcgagtggctg
cgcgcctggagcgggcttcgcccgcgcctcacgggggattcgagcaatccggtcatcggg
ccgtggcccggcgcggaggggctcattctcgccgtcggccactttcgcaacggcgtgttg
ctcgcgcccatcacgggccgcatcgtggcgagcgccgcgctcggccgcgcgcccgaggat
ctgtggctgccattttggccgcaaacgcgcttcgcggctcggggaggtgatgtgcgtgcg
gatacgcttgaacggtaa

DBGET integrated database retrieval system