KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2530Help
Entry
Aaci_2530         CDS       T00985                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aaci_2530
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aaci_2530
   00630 Glyoxylate and dicarboxylate metabolism
    Aaci_2530
Enzymes [BR:aac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Aaci_2530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2601298..2602902
Genome map
AA seq 534 aa AA seqDB search
MAGSYACPQGVQITGEYRPEFAEILTTDALQFIAELERRFGPRRDELLRLRKERDERLLA
GEWPDFLPETKEIRESEWTVGPIPADLQDRRVEITGPSSDRKMVINALNSGAKCFMADFE
DACAPSWENVVQGQINMRDAVRRTIEYTSPEGKHYKLNDEVAVLIVRPRGWHLPEKHIRV
DGRVATGALVDFGLYFYHNAKELLARGTGPYFYLPKMESHLEARLWNDVFNYAQDALGIP
RGTIKATVLIETILATFEMDEILYELRDHAAGLNCGRWDYIFSYIKKFRNHPEVILPDRA
QVTMTVPFMRAYTLLTIRTCHRRKAFAMGGMAAQIPIKNDPKANEEALAKVRADKEREAQ
DGHDGTWVAHPGLVPVAMEVFNRLMPTPNQLHRLREDVQVTAADLVAVPQGTITEGGLRT
NVAVALRYIEAWLRGSGAVPIFNLMEDAATAEISRAQIWQWIHHPKGVLDDGRKVTVELF
RQILEEELRKLKDEIGEEAYAQSKFPLAAELLDDISTKDDFVDFLTLPGYEHLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatcgtacgcttgcccacagggcgtgcaaatcacgggcgaatacaggcctgag
ttcgccgaaatcctcacgacggacgcgcttcaattcatcgcggagcttgagcgccgcttc
ggtccgaggcgggacgaactgcttcgcctgcgcaaggagcgggacgagcggttgctcgcg
ggcgaatggccggacttcttgccggagaccaaggagattcgcgagagcgagtggacggtc
gggcccatccccgcggatctgcaggatcggcgcgtggaaatcacgggcccgagttcggac
cggaagatggtcatcaacgccttgaactcgggcgccaagtgcttcatggcggactttgag
gacgcctgcgcaccgtcctgggagaacgtcgtgcagggtcagatcaacatgcgggacgca
gttcgccgcaccatcgaatacacgagccccgaggggaagcactacaagctgaatgacgaa
gttgcggtgctcatcgtgcgcccgcgcggctggcacctgcccgagaagcacatccgggtg
gacggccgggtggccacgggcgcgctcgtcgacttcgggctttacttctaccacaatgcc
aaggagcttttggcgcgcggcaccgggccctacttctacctgccgaagatggagagccac
ctcgaggcgaggctgtggaacgacgtgttcaactacgcccaggacgcgctcggcatcccg
cgcggcaccatcaaggccactgtgctcatcgagaccatcctcgcgacgttcgagatggac
gagatcctgtatgagctgcgcgatcacgccgcggggctcaactgcggccgctgggactac
atcttcagctacatcaagaagttccgcaatcacccggaggtcatcctgcctgaccgggcg
caggtgacgatgacggtgccgttcatgcgcgcgtacaccctgctcaccatccgcacgtgc
catcggcgcaaggcgttcgcgatgggcggcatggcggcgcagatccccatcaagaacgac
ccgaaggcgaacgaggaggcgctcgccaaggtgcgcgcggacaaggagcgcgaggcgcag
gacggccacgacggcacctgggtggcgcacccgggtctcgtgcccgtggcgatggaggtg
ttcaatcgcctcatgcccacgcccaaccagttgcaccgcctgcgcgaggacgtccaggtc
accgcggccgatctcgtcgcggtcccgcagggcaccatcaccgaaggcggcctgcgcacc
aacgtcgccgtggcgcttcgctacatcgaggcttggctgcgcggttccggcgcggtgccc
atcttcaacctgatggaagacgcggcgacggcggagatctcccgcgcgcagatctggcag
tggatccatcacccgaaaggcgtcctcgacgacggccgcaaggtgacggtggagctgttc
cggcagattctcgaagaggagttgcgcaagttgaaggacgagatcggcgaggaggcgtac
gcacagagcaagttcccgctcgcggccgaacttctcgacgacatctcgacgaaggacgac
ttcgtcgacttcctgacgctgccgggttacgagcacctggcgtga

DBGET integrated database retrieval system