KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2733Help
Entry
Aaci_2733         CDS       T00985                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aac00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Aaci_2733
Enzymes [BR:aac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Aaci_2733
Amino acid related enzymes [BR:aac01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Aaci_2733
Transfer RNA biogenesis [BR:aac03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Aaci_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2797983..2799467)
Genome map
AA seq 494 aa AA seqDB search
MSVRVRFAPSPTGHLHIGGVRTALFNFLYARHTGGQFILRLEDTDVDRNVAGAEQAFVEA
FRWLGLAWDEGFDIGGPYGPYRCSERIAIYRGHAEKLLESGMAYACFCLQGEAKEVRPEE
DADDGPSAGASGCTGSCSSLDPAEALKRIQAGEPHAIRFRAPSGPPIVVRDIVRGEIAFE
REDLRDFVIIKRDGMPTYNFQVAVDDHLMAITHVIRGEEHLSNTPRQLLIYEAFGWQPPQ
FAHLPIVLDESRKKLSKRDPNVLPVSAYREQGYVPQAIVNFLALLGWSPGDEEEIFDLDE
LCARFDLDRVGRAGAVFDVAKFRWMANQYFKSLDPKEAVRLIREQAVRLNYSFPPYVDDE
WLERAVALVQDGLACAREFFTAARVWLEPEVAYDEEARALLATEGAARVVRAYLSACEQD
PSWDEAANRARFQAVGRALGVKGRDLFMPVRAAVTGHTHGPDLQKSMALLPKEMAVERMR
RALAFAQAPEHQGR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgcgcgtgcggttcgccccaagtccgacgggccatctccacatcggcggtgtg
cgcacggcgctcttcaacttcctctacgcgcggcacaccggggggcagttcatcctgcgg
ctcgaggacacggacgtggaccgaaacgtcgccggggcggagcaggcgtttgtggaggca
ttccgctggctcggcctggcgtgggacgagggtttcgacatcggcgggccgtacgggccg
tatcggtgcagcgagcggatcgccatctatcggggccatgcggagaagctgctggaatcc
gggatggcgtacgcgtgcttctgccttcagggcgaggcgaaggaagttcgcccggaagag
gatgccgacgatggcccgagtgcgggcgcgagcggctgcaccgggtcgtgttcgtcgctc
gatccggcggaggctttgaagcgtatccaggcgggcgagccgcacgccatccggttccgc
gcgccgtccggtccgcccatcgtggtgcgggatatcgtccggggcgagatcgcctttgag
cgcgaggatctgagggacttcgtcatcatcaagcgggatggcatgccgacgtacaacttt
caggtggccgtcgacgatcatctcatggccatcacgcacgtgattcgaggcgaggagcat
ttgtccaacacgccgcgccagctcctcatctacgaggcgtttggctggcagcctccgcaa
ttcgcgcatctgccgattgtgctcgatgagtcgcggaagaaattgtcgaagcgcgatccg
aacgtcctgccggtgtcggcataccgcgagcagggctacgtcccgcaggccatcgtgaac
ttcttggcgctcctcggatggtctcctggggatgaagaggaaatctttgatctggacgag
ctttgcgcgcggttcgatctcgaccgcgtcgggcgcgccggtgccgtgttcgacgtcgcc
aagttccgctggatggcgaaccagtacttcaagtcgcttgacccgaaggaggcggttcgg
ctcatccgcgaacaggctgtgcgcctgaactattcgtttccgccgtacgtggacgacgag
tggctcgagcgggccgtggcccttgtccaggacggcctcgcctgtgcgcgggaattcttc
accgccgcgagggtgtggcttgagcccgaagtggcgtacgatgaagaagcgcgtgcgctg
ctcgcgaccgagggcgccgctcgcgtggttcgtgcgtatctgtcggcgtgcgaacaggat
ccgtcctgggatgaggcggccaatcgggcccgttttcaggcggtgggacgggcgcttggc
gtgaagggacgagatctgttcatgcccgttcgggccgctgtgaccggtcatacgcacggc
cccgatctgcagaagtcgatggcgcttcttccgaaagagatggcggtggaacgcatgcgc
cgcgccctcgcgtttgcacaagcgccggagcatcaggggaggtga

DBGET integrated database retrieval system