KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2885Help
Entry
Aaci_2885         CDS       T00985                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00330  Arginine and proline metabolism
aac00332  Carbapenem biosynthesis
aac01100  Metabolic pathways
aac01130  Biosynthesis of antibiotics
aac01230  Biosynthesis of amino acids
Module
aac_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Aaci_2885
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Aaci_2885
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Aaci_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACV59889
UniProt: C8WV52
Position
complement(2948496..2949623)
Genome map
AA seq 375 aa AA seqDB search
MSRDGRGRRRVVVKIGSSSLTEADGSLALSRMRQMVSDMVRLERESGCQFVLVSSGAIAA
GLGRLGWQRAHISMPEKQAAAAVGQVLLMEHYERLFAEHGIAVGQILMTRADVEDRKRFV
NIRNTVMALLQRGVMPIINENDTVAVDEIRFGDNDTLAALVALVAEADTLVLLTDIDGLY
TANPRQDPTATRIAEVEAITDEIERIAGGAGSSAGTGGMRTKIAAAKIATQSGVEVVIAH
RDEPRVLERVLGGEPVGTRFLASREPVSLRKSWLLHAPKPEGALQVDHGAMRALIAGGKS
LLLPGLVQVHGEFQEGAVVELVGPTGAAFGKGISNFSSRDLAEWLAKKRAGEDVHALHEV
VHRNDMVIWTEATAG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagggatggacgtgggcgcagacgcgtggtggtgaaaattgggtcgagctcactc
accgaggcggacggatcgctcgcactgtcgcggatgcgccagatggtgtccgatatggtg
cggctcgagcgtgagtcggggtgccagtttgtgcttgtctcctcgggcgccatcgcggcg
gggctcggcaggctcggctggcagcgcgcgcacatctcgatgccggagaagcaggcggcc
gcggcggtgggccaggtgctcctcatggagcactacgagcggctgtttgccgagcacggc
atcgcggtggggcagatcctcatgacgcgcgcggacgtggaggataggaagcggtttgtg
aacatccgcaacacggtgatggccctgctccagcgcggcgtgatgcctatcatcaacgag
aacgacaccgtggcggtggacgagatccgcttcggcgacaacgacacgctggcggcgctc
gtggcgctcgtggcggaggcggacacgttggtgctgctcaccgatatcgacggcctgtac
acggccaacccgcgccaggatcccacagcgacgcggattgcggaggtcgaggccatcacg
gacgagatcgagcgcatcgcgggcggagccggatcgagcgcaggcacgggcgggatgcgg
acgaaaatcgcggcggcgaagattgccacgcagtccggcgtggaggtcgtcattgcgcat
cgggacgagccgcgggtgcttgagcgggtgctcggcggcgagccggtgggcacgcggttt
ctggcgtcgcgggagccggtcagcctgcgcaagtcgtggctcttgcacgcgccgaagccg
gaaggcgccctgcaggtggatcacggcgccatgcgcgcgctcatcgcgggcggcaagagc
ctgcttttgccgggcctcgtgcaggtgcatggcgagtttcaggagggcgccgtggtggaa
ctcgtcgggcccaccggcgcggcgtttggcaagggcatctcgaacttctcctcgcgcgat
ctcgccgagtggctcgcgaaaaagcgcgcaggcgaggacgtgcacgcgctgcacgaagtg
gtgcaccgaaacgacatggtgatctggacggaggcgacggcgggatga

DBGET integrated database retrieval system