KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2891Help
Entry
Aaci_2891         CDS       T00985                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Aaci_2891
Enzymes [BR:aac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Aaci_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2957190..2959256
Genome map
AA seq 688 aa AA seqDB search
MAKHAPIFPNVQGFLHGGDYNPDQWLAYPDVLEQDVQLMREAKWNVVSLGIFSWVSLEPE
EGLFTFEWLDEAIERLTHAGVRILLATPSGARPAWLSAKYPEVLRVGPDGRRNRHGGRHN
HCYTSPIYREKVRIINRKLAERYAHHPGVIGWHVSNEYGGECHCPLCQEAFREWLKRKYK
TLDALNHAWWTPFWSHTYTDWSQIESPMPHGETSIHGLNLDWKRFVTDQTVDFCRHEIEP
LKQVNPNLPVTTNFMGTYPGLNYWRFRDVLDVISWDSYPRWHAHETLVPEAVHTAMVHDL
NRSILKKPFLLMESTPSVTNWQAVSKQKRPGVHVLVSLQAVAHGADSVQYFQWRKSRGSY
EKFHGAVVDHVGHANTRVFRDVQAVGEMLERLAPMAGAEVKADAAVIFDWENRWALEDAK
GPRNIGMHYEETVVNHYAALWRMGVPMDVIDEEQPLDGYKLVVAPMLYMVRPGVAERMKA
FVERGGSLVLTYWSGIVDENDLVFLGGFPGPLRELAGVWAEEIDALYDGERVPVRVADGN
PLGLAGHYEARELCEVVHLEGAEPIAVYGADYYEGMPAATVHRVGKGKVYYVAARLEDAF
LRDFFARVAAEAGVARAIERELPDGVSAMVRSGDGVEYVMLMNFTPEAREVALDEAEYKP
LYGEAPTDGAVRLPAYGVSVLERPARNG
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagcacgcacccattttcccgaacgttcaaggttttttgcacggaggcgattac
aaccccgatcagtggctggcgtatccggatgtcctcgaacaggatgtccagctgatgcgc
gaagcgaagtggaacgtcgtctctctgggcatcttctcctgggtgagcctggagcccgag
gagggcttgttcacgtttgaatggctcgacgaggccatcgaacgtctgacgcatgcgggc
gtgcggattctgctcgccacgccgagcggcgcgcggcccgcctggctatccgccaaatac
cccgaagtccttcgcgtcggacccgacgggcggcgcaaccggcacggcggccgccacaac
cactgctacacgtcgcccatctaccgcgagaaggtgcggatcatcaaccggaagctggcg
gagcggtacgcccatcatccgggcgtgatcggctggcacgtgtcgaacgagtacggcggc
gagtgccactgcccgctgtgccaggaggcgtttcgcgagtggctgaagcgaaagtacaag
acgcttgacgcgctcaaccacgcatggtggacgccgttttggagccacacgtatacggat
tggtcgcagatcgagtcgcccatgccgcacggcgagacgtcgattcacgggctgaacctc
gactggaagcggttcgtgacggatcagacggtcgacttctgccgccatgagattgagccc
ctcaaacaggtgaatccgaatcttccagtcaccaccaacttcatgggcacgtatccaggc
ctcaactactggcgcttccgcgacgtgctcgacgtcatctcgtgggacagctatccgcgc
tggcacgcgcacgagacgctcgtcccggaggcggtgcacaccgccatggtgcacgatctc
aaccgctccatcctcaagaagccatttctgctcatggagtccacgccgagcgtcaccaac
tggcaggcggtgagcaaacagaagcgccccggcgtgcacgtgctcgtctccctccaggcc
gtcgcgcacggcgccgattcggtgcagtacttccagtggcgcaaaagccgcggatcgtat
gaaaaattccacggcgccgtggtcgatcacgtcggccacgccaacacccgggtgttccgc
gacgtgcaagccgtcggcgagatgctggagcggcttgcgccgatggccggcgcggaggtg
aaggcggacgcggccgtcatcttcgactgggagaaccgctgggcgctcgaggacgcgaag
ggcccgcggaacatcggcatgcactacgaggagacggtcgtgaaccactacgcggcgctt
tggcgcatgggcgtgccgatggacgtgatcgacgaggaacagccgcttgacgggtacaaa
ctggtcgtcgcgccgatgctctacatggtgcgccccggcgtggccgagcggatgaaggcg
ttcgtcgagcggggcgggtcgctcgtcctcacgtactggtccggcatcgtggatgagaac
gatctcgtctttttgggcggcttcccgggcccgctgcgcgaacttgcgggcgtgtgggct
gaggagatcgacgcgctgtacgacggcgagcgggtgccggttcgagttgccgacggcaat
ccgcttggcctcgcgggccactacgaggcgcgcgaactgtgcgaggtggttcacctcgag
ggcgcggaacccatcgcggtgtacggcgcggactactacgagggcatgcccgcggcaacg
gttcaccgcgtgggaaagggcaaggtctactacgtggccgcgcggctcgaggacgcgttt
ttgcgcgatttctttgctcgcgtggctgcggaagccggcgtggcgcgcgccatcgagcgg
gagctgccggatggcgtaagcgcgatggtgcgctcgggagatggcgtggagtacgtcatg
ctcatgaacttcacgcccgaggcgcgcgaggtggcgctcgatgaagcggagtacaagcca
ctctatggagaagcgccgacagacggcgcggttcggctccccgcctacggtgtgagcgtg
ctcgagcgaccggcgcgaaatgggtga

DBGET integrated database retrieval system