KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_0143Help
Entry
AANUM_0143        CDS       T04531                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:aacn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AANUM_0143 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    AANUM_0143 (atoB)
   00640 Propanoate metabolism
    AANUM_0143 (atoB)
   00650 Butanoate metabolism
    AANUM_0143 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    AANUM_0143 (atoB)
   00072 Synthesis and degradation of ketone bodies
    AANUM_0143 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AANUM_0143 (atoB)
   00310 Lysine degradation
    AANUM_0143 (atoB)
   00380 Tryptophan metabolism
    AANUM_0143 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AANUM_0143 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AANUM_0143 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AANUM_0143 (atoB)
Enzymes [BR:aacn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AANUM_0143 (atoB)
Exosome [BR:aacn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AANUM_0143 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
134440..135621
Genome map
AA seq 393 aa AA seqDB search
MENIVIVSAVRTPIGSFNGSLAAVSAVDLGATVIKEVINRADIDSALVNEVIMGNVLQAG
IGQNPARQAALKAGVAKGIPSYTVNKVCGSGLKSVALGAQAIASGDADIVAAGGMESMSQ
APYILDHKIRSGVRMGNLPLRDSMIEDGLTCAINHYHMGITAENIAEQYGISREEQDQLA
LRSQTLASQAVQNGVFDKEIVSVTVKTRKGDIAVSRDEYPKPDTTAEGLAKLRPAFKKDG
TVTAGNASGINDGAAALLLMSESKANALGLKPLARIRGYASAGVDPAVMGLGPVPATQKA
LRKAGLTLDDIDLIEANEAFASQFLGVGRELHFNMEKTNIHGGAISLGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGEGISVIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatcgttatcgtcagcgcggtcagaacgccgatcggcagctttaacggcagt
cttgccgccgtcagtgcggttgatctgggcgctaccgtgatcaaagaagtgatcaaccgc
gcagacatcgacagcgccttggtcaacgaagtgattatgggtaatgtgctgcaagccggt
atcggacaaaaccctgcccgtcaagctgcactcaaagcgggcgtggcgaagggaattccg
tcctacactgtcaataaagtctgcggttcgggcttaaaaagcgtggcgttgggcgcgcaa
gccattgccagcggcgacgccgacatcgtggcggccggcggcatggaaagtatgagccaa
gcgccgtacattctggatcataaaatccgttccggcgtcagaatgggcaatctgccgttg
cgcgacagcatgatcgaagacggtctgacgtgcgccataaaccattaccacatgggcatt
acggcggaaaatatcgccgaacaatacggtatcagccgtgaggaacaggatcagcttgcg
ctgcgttcgcaaacccttgcctctcaagcggtgcaaaacggcgtattcgacaaagaaatc
gtatctgtcaccgtgaaaacccgcaaaggcgacatcgctgtctcccgcgacgaatacccg
aaacccgacaccacagcggaagggctggcgaagttaagaccggcattcaaaaaagacggt
accgtcaccgccggtaacgcctccggtattaacgacggcgccgccgcgttattgttaatg
agcgaaagcaaagcgaacgcattaggactgaaaccgctcgcccgtatccgcggttacgcc
agtgcaggagtcgatcctgccgtgatgggattggggccggtgccggcaacccagaaagcg
ctgcgcaaagcgggattgacgctcgacgatattgacctgatcgaagcgaacgaagccttc
gcctcgcaattcctcggcgtcggcagagaactgcatttcaatatggagaaaaccaatatc
cacggtggtgccatctcgctgggtcaccctatcggcgccagcggcgccagaattctggtg
acgctgctgcacaatctcattgagaaagacaaaaagctcggtctggcgaccctgtgtatc
ggcggcggggaaggcatttcagtgattgtcgaacggatctga

DBGET integrated database retrieval system