KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0033Help
Entry
TC41_0033         CDS       T01821                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:aad01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:aad00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36508..37791
Genome map
AA seq 427 aa AA seqDB search
MTYFKTAAELEQHWKTDPRWKGVERAYTAEDVIRLRGSVHIEHTLAQMGAEKLWRRLHED
GFIRALGALTGNQAVQQVKAGLKAIYVSGWQVAADANLAEHMYPDQSLYPSNSVPSLVRR
INNALLRADQIQTAEGKGDIDWMVPIVADAEAGFGGPLNVFELMKMMIEAGAAGVHFEDQ
LSSEKKCGHMGGKVLIPTSHAVRNLTAARLAADVLGVPTIIVARTDANGAFLITSDVDDR
DARFITGERTPEGFYRFRGGLEAAIARGLAYAPYADMIWCETSEPNIEEAKRFAEAIKAE
FPDKLLAYNCSPSFNWRKKLDPKTIEEFQEIIASFGYKFQFVTLAGFHALNYSMFELAYG
YNQRGMGAYSDLQQQEFAAEARGYTATRHQREVGTGYFDEVAQVVSGGLSSTTALTGSTE
EEQFVEA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacatacttcaaaacggcggcggaactggagcagcattggaagacggatcctcgttgg
aaaggcgtcgagcgcgcctatacggcggaagacgtgattcggctcaggggatcggtgcac
attgaacatacactcgcgcagatgggcgcggagaagctgtggcggcgcctccatgaagac
ggcttcatccgcgcgctcggtgccctgactggcaaccaggccgtgcagcaggtcaaggcc
ggcctgaaggccatctacgtcagcggctggcaggtggcagcggacgccaacctggccgag
cacatgtacccggatcagagcctgtacccgtccaacagtgtgccgagcctggtgcggagg
atcaacaacgcgctgttgcgcgcggatcagattcagaccgcggaaggcaagggcgacatc
gactggatggtgccgattgtagccgacgcggaggcaggatttggcgggccgctgaacgtg
ttcgagctcatgaagatgatgattgaagccggcgccgcgggcgtgcacttcgaggatcag
ctgtcatcggagaagaaatgcggccacatgggcggcaaggtgctcatccccacgtcgcac
gcggtgcggaatctgacggctgcgcgcctcgcggccgacgtgctcggcgtgccgaccatc
atcgtggcgcgcacggacgccaacggcgcgttcctcatcacgagcgatgtcgacgatcgc
gacgcgcggttcatcacgggcgagcgcacgccggaagggttctaccggttccggggcggg
ctggaggccgcaattgcccgcggactcgcctacgcgccctacgcggacatgatctggtgc
gagacgtccgagcccaacatcgaggaagcgaagcggtttgcggaggctatcaaggccgaa
ttcccagacaaactcctcgcctacaactgctcgccttccttcaactggcggaagaagctc
gatccgaagaccatcgaggagttccaggagatcatcgcgtcgttcggctacaagttccag
ttcgtgaccctggcgggcttccacgccctcaattacagcatgttcgagctcgcatatggc
tacaaccagcgcggcatgggggcgtactcggatctccagcagcaagagtttgctgcggaa
gcccgcggctataccgcgacacgccatcagcgggaggtgggtacgggctacttcgatgaa
gtggcgcaggtggtgtcgggcggactttcgtccacgacggcgctcaccggctccacggag
gaggagcagtttgtggaggcgtga

DBGET integrated database retrieval system