KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0033Help
Entry
TC41_0033         CDS       T01821                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00630  Glyoxylate and dicarboxylate metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01200  Carbon metabolism
Module
aad_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TC41_0033 (aceA)
Enzymes [BR:aad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TC41_0033 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEJ42013
UniProt: F8IHP6
Position
36508..37791
Genome map
AA seq 427 aa AA seqDB search
MTYFKTAAELEQHWKTDPRWKGVERAYTAEDVIRLRGSVHIEHTLAQMGAEKLWRRLHED
GFIRALGALTGNQAVQQVKAGLKAIYVSGWQVAADANLAEHMYPDQSLYPSNSVPSLVRR
INNALLRADQIQTAEGKGDIDWMVPIVADAEAGFGGPLNVFELMKMMIEAGAAGVHFEDQ
LSSEKKCGHMGGKVLIPTSHAVRNLTAARLAADVLGVPTIIVARTDANGAFLITSDVDDR
DARFITGERTPEGFYRFRGGLEAAIARGLAYAPYADMIWCETSEPNIEEAKRFAEAIKAE
FPDKLLAYNCSPSFNWRKKLDPKTIEEFQEIIASFGYKFQFVTLAGFHALNYSMFELAYG
YNQRGMGAYSDLQQQEFAAEARGYTATRHQREVGTGYFDEVAQVVSGGLSSTTALTGSTE
EEQFVEA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacatacttcaaaacggcggcggaactggagcagcattggaagacggatcctcgttgg
aaaggcgtcgagcgcgcctatacggcggaagacgtgattcggctcaggggatcggtgcac
attgaacatacactcgcgcagatgggcgcggagaagctgtggcggcgcctccatgaagac
ggcttcatccgcgcgctcggtgccctgactggcaaccaggccgtgcagcaggtcaaggcc
ggcctgaaggccatctacgtcagcggctggcaggtggcagcggacgccaacctggccgag
cacatgtacccggatcagagcctgtacccgtccaacagtgtgccgagcctggtgcggagg
atcaacaacgcgctgttgcgcgcggatcagattcagaccgcggaaggcaagggcgacatc
gactggatggtgccgattgtagccgacgcggaggcaggatttggcgggccgctgaacgtg
ttcgagctcatgaagatgatgattgaagccggcgccgcgggcgtgcacttcgaggatcag
ctgtcatcggagaagaaatgcggccacatgggcggcaaggtgctcatccccacgtcgcac
gcggtgcggaatctgacggctgcgcgcctcgcggccgacgtgctcggcgtgccgaccatc
atcgtggcgcgcacggacgccaacggcgcgttcctcatcacgagcgatgtcgacgatcgc
gacgcgcggttcatcacgggcgagcgcacgccggaagggttctaccggttccggggcggg
ctggaggccgcaattgcccgcggactcgcctacgcgccctacgcggacatgatctggtgc
gagacgtccgagcccaacatcgaggaagcgaagcggtttgcggaggctatcaaggccgaa
ttcccagacaaactcctcgcctacaactgctcgccttccttcaactggcggaagaagctc
gatccgaagaccatcgaggagttccaggagatcatcgcgtcgttcggctacaagttccag
ttcgtgaccctggcgggcttccacgccctcaattacagcatgttcgagctcgcatatggc
tacaaccagcgcggcatgggggcgtactcggatctccagcagcaagagtttgctgcggaa
gcccgcggctataccgcgacacgccatcagcgggaggtgggtacgggctacttcgatgaa
gtggcgcaggtggtgtcgggcggactttcgtccacgacggcgctcaccggctccacggag
gaggagcagtttgtggaggcgtga

DBGET integrated database retrieval system