KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0072Help
Entry
TC41_0072         CDS       T01821                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aad00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74844..76421
Genome map
AA seq 525 aa AA seqDB search
MVRHAGFVRRLFVSTADSFLVEGIMGARTFILAFDQGTTSSRAILFDRAGRIHSIAQKEF
TQIYPKLGWVEHDPMEIWGTQSGVAREVLEKAAVSPEQVAAIGITNQRETTVVWEKETGK
PVYNAIVWQDRRTADICDQLKVAGHADLIRDKTGLVIDAYFSGTKIKWILDHVEGARERA
ERGELLFGTIDTWLVWNLTRGKVHVTDYTNASRTMLFNIHTLDWDDDLLKLLGIPRAMLP
EVRPSSSIYGHTDEHTFGGANIPIAGIAGDQQAALFGQTCFEPGMVKNTYGTGCFMLMNT
GEKPVASPSGLLTTIAWGLEDKVTYALEGSVFIAGAAIQWLRDGLRFFDSAADSEYFASK
VEDTGGVYVVPAFAGLGAPYWDMYARGAIFGLTRGTRKEHIIRATLESLAYQTKDILDAM
QRDSGIELKSLRVDGGAVANNLLMQFQADILGVPVERPQIAESTALGAAYLAGLAVGFWT
KDEIARSGDLDRRFDPQMDSETRARLYRGWQRAVERTMGWAQEDV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtggttcgccatgcgggctttgtccgccgtctgtttgtatcgaccgcagactcgtttctt
gtggagggtattatgggcgcacgaacgttcatcctcgccttcgatcaaggcacaaccagt
tcccgcgcgattttgttcgatcgcgccgggcgcattcacagcatcgcccagaaggagttc
acccagatctatccgaagctcggctgggtcgaacatgacccgatggagatctggggaacg
cagagcggcgtcgcgcgcgaggtgctcgaaaaggcggccgtgtccccggaacaggtggcg
gccatcgggatcaccaaccagcgcgagaccactgtggtatgggaaaaggagaccggcaaa
cccgtctacaacgccatcgtatggcaagatcgccgcacggccgacatttgcgaccaactg
aaggtggccgggcacgccgatttgatccgcgacaagacgggcctagtcatcgatgcctac
ttctccggcacgaagatcaagtggattctcgatcacgtcgagggtgctcgcgagcgcgct
gaacgcggcgagttgcttttcggcaccatcgacacctggcttgtgtggaacctgacgcgc
ggcaaggttcacgtaacggactacacgaacgcgtcccgcaccatgctcttcaacattcac
acgctcgactgggacgatgatctcctgaagctcctcggcatcccgcgcgccatgctgccc
gaggtccgcccttcctcgtccatctacggccacaccgacgagcacacgtttggcggcgcg
aacatccccatcgctggcattgcaggagatcagcaggcggcgctctttggacagacgtgc
ttcgaaccggggatggtcaagaacacgtacggaacgggctgcttcatgctcatgaacaca
ggcgagaaacccgtggcatcgccgtctgggctgttgacgaccatcgcctgggggctcgag
gacaaagtcacgtatgcgctcgagggaagcgtcttcatcgcgggcgcggcgattcagtgg
ttgcgcgacgggctgcgcttcttcgactcggcggccgactcggaatactttgcgagcaaa
gtggaggacactggcggcgtgtacgtcgtgccggcgttcgcggggctcggtgccccgtac
tgggacatgtacgctcgcggcgccatcttcggactgacgcgcggaactcgcaaggagcac
atcattcgagccacgcttgagtcgctcgcgtatcagacgaaagacatcctggacgcgatg
cagcgggattccggtattgagctgaagtcgctgcgggtggatggcggtgcagtcgcgaac
aacctgctcatgcagttccaggcggacattctcggcgtgccggtcgagcgcccgcagatc
gcggagtccacggctcttggcgccgcgtatctcgcggggctagccgtgggattttggaca
aaggacgagatcgcccgcagtggagacctcgaccgcaggttcgacccgcagatggactcc
gaaacccgggcgcgcctgtatcgaggatggcagcgcgccgtggagcgcacgatgggatgg
gcgcaggaggacgtgtga

DBGET integrated database retrieval system