KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0106Help
Entry
TC41_0106         CDS       T01821                                 

Gene name
glk
Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TC41_0106 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_0106 (glk)
   00052 Galactose metabolism
    TC41_0106 (glk)
   00500 Starch and sucrose metabolism
    TC41_0106 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TC41_0106 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TC41_0106 (glk)
   00524 Butirosin and neomycin biosynthesis
    TC41_0106 (glk)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TC41_0106 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115656..116597
Genome map
AA seq 313 aa AA seqDB search
MEQKLALGIDIGGTNVKLAIVRSDGRVLADKSIPTAPDRGPEAFSRTVGAEARAMADEAS
VAWDSVVGAGVGMAGFLDVERGWVEEAVNLHWRDVPLADLLQASLDKPVRVDNDANVAAL
GEVWLGAGQNAHTALCVTLGTGVGGGIVIGGRIHRGASTMAGEIGHIMVKNGGELCNCGH
RGCLETLASATALVRHAVAAGVKSPDGGELTAKDVFALAAEGHPAARAVVDDMIHWLAVG
LAIVANILNPDVIVVAGGLVNAGDQLMAPLREAFQREALARVARACRLVPAKLGDQAGVL
GAARLVLQDIESL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagcttgcgcttggcatcgatattggcggcacaaacgtgaaattggccatc
gtgcgaagcgatggccgcgtgttggcggacaagtccatccccacggcccccgaccggggg
ccggaggccttctcccgcacggtcggcgcagaggctcgtgccatggcggacgaggcgtcc
gtggcgtgggactccgtcgtgggagcgggtgtgggcatggcgggcttcctggacgtggag
cgcggatgggtggaggaagcggtcaacctgcattggcgagacgtccccctagcggatctg
ctccaggcgtcgctagacaaacctgtccgcgtggacaacgacgcaaacgtcgcggcgctc
ggcgaagtgtggctcggcgcgggtcagaacgcgcacaccgcgctctgcgtgacgctcggc
accggtgtcggcggcggcatcgtcattggcgggcgcattcaccgcggcgcttcgaccatg
gcgggtgaaatcggtcacatcatggtgaaaaacggcggggaactgtgcaactgcggccac
cgcggctgcctggagaccctcgcctcggccaccgcgctcgtgcgccacgctgtggcggcg
ggcgtcaagagcccggacggcggagagctcaccgcgaaagacgtctttgcgctggcagca
gagggccatccggccgcgcgcgcggtggttgacgacatgattcattggcttgcggtcggg
ctggcgattgtcgccaacatcctgaacccggacgtcatcgtcgtcgcgggcgggctcgtg
aacgcgggagatcagctgatggcgccgctccgcgaggcatttcaacgtgaggcgctggcc
cgcgttgcgcgcgcgtgcagattggttccggcgaaactcggggatcaggcgggcgtcctg
ggcgccgcccggctcgtgttgcaggatatcgaaagcctgtga

DBGET integrated database retrieval system