KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0106Help
Entry
TC41_0106         CDS       T01821                                 

Gene name
glk
Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00010  Glycolysis / Gluconeogenesis
aad00052  Galactose metabolism
aad00500  Starch and sucrose metabolism
aad00520  Amino sugar and nucleotide sugar metabolism
aad00521  Streptomycin biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
Module
aad_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aad_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_0106 (glk)
   00052 Galactose metabolism
    TC41_0106 (glk)
   00500 Starch and sucrose metabolism
    TC41_0106 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TC41_0106 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TC41_0106 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TC41_0106 (glk)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TC41_0106 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Pan_kinase DEDD_Tnp_IS110 FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEJ42084
UniProt: F8IIC5
Position
115656..116597
Genome map
AA seq 313 aa AA seqDB search
MEQKLALGIDIGGTNVKLAIVRSDGRVLADKSIPTAPDRGPEAFSRTVGAEARAMADEAS
VAWDSVVGAGVGMAGFLDVERGWVEEAVNLHWRDVPLADLLQASLDKPVRVDNDANVAAL
GEVWLGAGQNAHTALCVTLGTGVGGGIVIGGRIHRGASTMAGEIGHIMVKNGGELCNCGH
RGCLETLASATALVRHAVAAGVKSPDGGELTAKDVFALAAEGHPAARAVVDDMIHWLAVG
LAIVANILNPDVIVVAGGLVNAGDQLMAPLREAFQREALARVARACRLVPAKLGDQAGVL
GAARLVLQDIESL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagcttgcgcttggcatcgatattggcggcacaaacgtgaaattggccatc
gtgcgaagcgatggccgcgtgttggcggacaagtccatccccacggcccccgaccggggg
ccggaggccttctcccgcacggtcggcgcagaggctcgtgccatggcggacgaggcgtcc
gtggcgtgggactccgtcgtgggagcgggtgtgggcatggcgggcttcctggacgtggag
cgcggatgggtggaggaagcggtcaacctgcattggcgagacgtccccctagcggatctg
ctccaggcgtcgctagacaaacctgtccgcgtggacaacgacgcaaacgtcgcggcgctc
ggcgaagtgtggctcggcgcgggtcagaacgcgcacaccgcgctctgcgtgacgctcggc
accggtgtcggcggcggcatcgtcattggcgggcgcattcaccgcggcgcttcgaccatg
gcgggtgaaatcggtcacatcatggtgaaaaacggcggggaactgtgcaactgcggccac
cgcggctgcctggagaccctcgcctcggccaccgcgctcgtgcgccacgctgtggcggcg
ggcgtcaagagcccggacggcggagagctcaccgcgaaagacgtctttgcgctggcagca
gagggccatccggccgcgcgcgcggtggttgacgacatgattcattggcttgcggtcggg
ctggcgattgtcgccaacatcctgaacccggacgtcatcgtcgtcgcgggcgggctcgtg
aacgcgggagatcagctgatggcgccgctccgcgaggcatttcaacgtgaggcgctggcc
cgcgttgcgcgcgcgtgcagattggttccggcgaaactcggggatcaggcgggcgtcctg
ggcgccgcccggctcgtgttgcaggatatcgaaagcctgtga

DBGET integrated database retrieval system