KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0115Help
Entry
TC41_0115         CDS       T01821                                 

Gene name
mtnD
Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00270  Cysteine and methionine metabolism
aad01100  Metabolic pathways
Module
aad_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TC41_0115 (mtnD)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     TC41_0115 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     TC41_0115 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding TMF_DNA_bd ATG16 Cupin_6 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AEJ42093
UniProt: F8IID4
Position
complement(121574..122194)
Genome map
AA seq 206 aa AA seqDB search
MPGGILRYTQAADVRGHGEAYKEVGVVAYVRIRNTGEEIHGEDQVREFLNRNEVYYDHWD
VDRRLPDALKGKFDLSDAEKDEILQALQEEIQDLSRKRGYVKWDVISLSESTPNLDELLK
KFEQVHTHTEDEVRAIVSGSGIFIIKGKDGGYFDVVLSAGDVISVPEGNPHFFTLTDERK
VVAVRLFIDPAGWVAHPYEDPAFQQA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcggaattctacgatatacgcaagcggcggatgtccgcggacatggagaagca
tacaaggaggtcggcgtggtggcatacgtacggattcgcaacacgggcgaagagatccac
ggcgaggaccaggtgcgcgaatttctgaaccgcaatgaggtctattacgatcactgggat
gtggatcggaggctcccggacgcgctcaagggcaagttcgatctctcggatgcggagaag
gatgagattcttcaggcgctgcaggaggaaatccaggacctctcccgcaagcgcggctac
gtgaagtgggacgtcatttcgctgtcggagtcgacgccgaatctggatgaactcctaaag
aagtttgaacaggtgcacacgcacaccgaggacgaggtccgcgccattgtgtcggggagc
ggtattttcatcatcaagggcaaggacgggggctatttcgacgtggtgcttagcgccggt
gacgtcatctcggtgccggagggcaacccgcacttcttcacgctcacagacgagcgcaaa
gtggtggctgtccgcctgttcatcgatccggcgggatgggtcgcgcacccgtacgaagat
cccgcatttcaacaggcgtga

DBGET integrated database retrieval system