KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0131Help
Entry
TC41_0131         CDS       T01821                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aad00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TC41_0131 (recR)
DNA repair and recombination proteins [BR:aad03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TC41_0131 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
133955..134554
Genome map
AA seq 199 aa AA seqDB search
MYGYPEPVARAIEHFMKLPGVGPKTAARLAFHVLEMSEADVKAFAKALIDLKTALTECAV
CCNITEASPCAICRDPRRDRRVICVVQEPRDVIAMERTREYHGLYHVLHGAISPMEGVGP
QDIRIRELVTRVGENEIEEVILATNPNVEGEATAMYISRLLKPFQIKLTRIAHGLPVGGD
LEYADEVTLAKALEGRRAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggtacccggagccggtggcgcgggccatcgaacatttcatgaagcttcccggc
gtggggccgaagacggccgcgcgcctggcatttcacgttctggaaatgagcgaggccgac
gtcaaagcctttgccaaggcgctgatcgatctcaagacggcgctcaccgagtgtgccgtc
tgctgtaacatcacggaagcgtctccgtgcgccatctgccgagacccgcgccgagaccgg
cgcgtcatctgcgtcgtgcaggaaccgcgagacgtgatcgccatggagcgcacgcgcgag
tatcatgggctgtaccacgtgctgcacggcgccatctcgccgatggagggcgtgggcccg
caggacattcggattcgggaactggtcacccgagtgggcgagaacgagattgaggaagtc
atcctcgccacgaacccaaacgtcgaaggcgaggcgacggccatgtatatctcgcgcctg
ctgaagccgttccagatcaagctgacgcgcatcgcgcacggtttgccggtgggcggcgat
ctcgagtacgcggatgaggtcacgctcgcgaaggccctggagggcaggcgagcgctgtag

DBGET integrated database retrieval system