KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0131Help
Entry
TC41_0131         CDS       T01821                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aad03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
133955..134554
Genome map
AA seq 199 aa AA seqDB search
MYGYPEPVARAIEHFMKLPGVGPKTAARLAFHVLEMSEADVKAFAKALIDLKTALTECAV
CCNITEASPCAICRDPRRDRRVICVVQEPRDVIAMERTREYHGLYHVLHGAISPMEGVGP
QDIRIRELVTRVGENEIEEVILATNPNVEGEATAMYISRLLKPFQIKLTRIAHGLPVGGD
LEYADEVTLAKALEGRRAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggtacccggagccggtggcgcgggccatcgaacatttcatgaagcttcccggc
gtggggccgaagacggccgcgcgcctggcatttcacgttctggaaatgagcgaggccgac
gtcaaagcctttgccaaggcgctgatcgatctcaagacggcgctcaccgagtgtgccgtc
tgctgtaacatcacggaagcgtctccgtgcgccatctgccgagacccgcgccgagaccgg
cgcgtcatctgcgtcgtgcaggaaccgcgagacgtgatcgccatggagcgcacgcgcgag
tatcatgggctgtaccacgtgctgcacggcgccatctcgccgatggagggcgtgggcccg
caggacattcggattcgggaactggtcacccgagtgggcgagaacgagattgaggaagtc
atcctcgccacgaacccaaacgtcgaaggcgaggcgacggccatgtatatctcgcgcctg
ctgaagccgttccagatcaagctgacgcgcatcgcgcacggtttgccggtgggcggcgat
ctcgagtacgcggatgaggtcacgctcgcgaaggccctggagggcaggcgagcgctgtag

DBGET integrated database retrieval system