KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0137Help
Entry
TC41_0137         CDS       T01821                                 

Gene name
fucA
Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TC41_0137 (fucA)
Enzymes [BR:aad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TC41_0137 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(139011..139679)
Genome map
AA seq 222 aa AA seqDB search
MDQVQQKKRELMEAAHKLKEAGLLFRGYHANLSTRISEDTMILTSGGSVERLDENGFALI
RLDGQVIEGDIAPVMAEIIQMHAGVYRERPSVGCVIHTHAPHATSFAVAQQPIPVVYEPL
VRFGVTEDIPVVPWAPRGSDASVKGIVQIVKERPGVWAVLLANHGVLAFSRTITETVQLL
ATLDEAAEIVLNARMLGGEKRLPDQAFTQIQERMREFAEVKR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggtgcaacagaagaagcgagaactgatggaggcagcacacaagctgaaggaa
gcggggctattgttccgcggatatcacgccaatctgtcaacacgcatttcagaggacacc
atgattctcaccagcggcggtagcgtcgaacgtttggatgaaaacggctttgcacttatt
cgcttggacggacaggtgatcgagggtgatatcgcacccgttatggctgaaatcattcag
atgcacgctggtgtataccgtgaacgtccgtccgtaggttgcgtgattcacacgcatgcg
ccacatgcgacctcgtttgcggtggctcagcaacctatccctgttgtgtatgagccactc
gtccgctttggtgtaacagaggatattccggtcgtcccttgggcgccacgcggttcggac
gcctcagtcaaaggcattgttcaaatcgtgaaagagcgaccaggtgtatgggcggttctt
ttggccaatcatggcgtgcttgcattctcgcgtacgatcaccgaaaccgttcaacttttg
gcgacccttgatgaagcagcagaaatcgtactgaatgcccgtatgctaggcggagagaag
cggttacctgaccaagcgtttacgcagattcaggaacggatgcgggagtttgcggaagtc
aaacggtga

DBGET integrated database retrieval system