KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0270Help
Entry
TC41_0270         CDS       T01821                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TC41_0270 (folP)
Enzymes [BR:aad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TC41_0270 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253123..253911
Genome map
AA seq 262 aa AA seqDB search
MTVVMGILNVTPDSFSDGGRYLDPEAAVARALEMEEEGAGIIDIGAESTRPGHTPLSPDE
EWRRLEPVLERLAGRLKVPISIDTYHAETARRAAQYGIAIVNDVSMLQDPDMPAVVRYHG
LRYVLMHTRREVLPGLPVAAMVEELRRPLARLLEEGVPARDILVDPGIGFGKTREQDLAC
LAEIGRFQALGHPVLVGASRKRVIGHVLGGVPVGERLAGSLAVVAHACMAGVDIVRVHDV
RDSVRVVRMMEAILAHGGSFAS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtggtcatggggattctgaacgtgacgccggactcgttctcggacggaggccgg
tatctggatccggaggcggccgtggctcgggcgctcgagatggaggaggaaggcgcaggc
atcatcgacatcggcgcggaaagcacgcggcccggacacacgccgctctcgccggacgag
gagtggcgccgcctggaaccggtgctcgagcggctcgcggggcggctcaaggtgcccatc
tccatcgacacgtaccacgccgagaccgcgcgcagggccgcacagtacggaatcgccatc
gtgaacgacgtgtccatgctgcaggatccggacatgcccgccgtcgtgcgctatcacggc
ctgcgctacgtgctcatgcacacgcgccgcgaggtgctgcccgggctccccgtggccgcc
atggtggaagaactccgccgcccactcgcgcggctcctcgaggaaggcgtgcccgcgcga
gacatcctcgtcgatcccggcatcggcttcggcaagacgcgcgagcaggatctcgcctgc
ctcgccgagatcggccgctttcaggcgctcggccatccggtgctcgtcggcgcgagccgc
aagcgggtcatcggccacgtgctcggcggcgtgccggtgggcgagcggctcgccggatcg
ctcgccgtggtggcgcacgcgtgcatggcgggcgtggacatcgtgcgcgtccacgacgtg
cgcgattcggtgcgcgtggtgcggatgatggaggcgattttggcgcatggcggatcgttc
gcttcatga

DBGET integrated database retrieval system