KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0315Help
Entry
TC41_0315         CDS       T01821                                 

Gene name
bdh
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aad00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:aad00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295619..296410
Genome map
AA seq 263 aa AA seqDB search
MKMEISLQGRVAVVTGAASGIGLAVATAMAEAGASVVLSDLRQDAAEAQAQALRQRGLEV
TAIAADASDEGEIDRLFTQAEAQYGRVDIVVNNAGMQHVAPIETFPTDVFRKMVDLMLTG
PFLSIKRALPGMKARGYGRILNMASINGLVGFAGKAAYNAAKHGLIGLTKVAALEAAEHG
VTVNALCPGYVDTPLVRNQLDDLARTRNVPVEQVLEDVIYPLVPQKRLLAPEEVAHYAVF
LASDLAASVTGQAVVMDGGYVAQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggagatttctttgcaagggcgtgtcgccgtcgtcaccggtgccgcgagtggg
attgggctcgccgtcgccacggccatggccgaagcgggggcgagcgtggtgttgtcagac
ctgcgccaggatgcggccgaagcgcaggcacaggccctgcggcagcgcggactggaggtg
acggccattgcggcggacgcctcggacgagggcgagatcgaccggctgttcacgcaggcg
gaagcgcagtatggccgcgtggatattgtcgtcaataacgcgggcatgcagcacgtggcg
cccatcgagacgtttccgacggatgtgtttcgcaagatggtggacctgatgctcacgggg
ccgttcttgagcatcaagcgggcgctgcccgggatgaaggcgcgcgggtatggtcggatt
ctcaatatggcctcgatcaacggcctcgtcgggtttgccggcaaggccgcgtacaacgcg
gcaaaacacggtctcatcggcctgacgaaggtggcggcgctcgaggcggccgagcacggt
gtgacggtgaacgcgctctgccctggctatgtggacacgccgctcgtacgcaaccagctg
gatgatctcgcccgcacgcgcaacgtccccgtggagcaggtgttggaggacgtgatttat
ccgctcgtgccgcagaagcgcttgctcgcgcccgaggaggtggcgcactacgccgtgttc
ctggcgtccgatctcgccgcgtctgtcacgggccaggccgtcgtgatggatgggggatac
gtggcgcagtaa

DBGET integrated database retrieval system