KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0315Help
Entry
TC41_0315         CDS       T01821                                 

Gene name
bdh
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TC41_0315 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    TC41_0315 (bdh)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     TC41_0315 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295619..296410
Genome map
AA seq 263 aa AA seqDB search
MKMEISLQGRVAVVTGAASGIGLAVATAMAEAGASVVLSDLRQDAAEAQAQALRQRGLEV
TAIAADASDEGEIDRLFTQAEAQYGRVDIVVNNAGMQHVAPIETFPTDVFRKMVDLMLTG
PFLSIKRALPGMKARGYGRILNMASINGLVGFAGKAAYNAAKHGLIGLTKVAALEAAEHG
VTVNALCPGYVDTPLVRNQLDDLARTRNVPVEQVLEDVIYPLVPQKRLLAPEEVAHYAVF
LASDLAASVTGQAVVMDGGYVAQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggagatttctttgcaagggcgtgtcgccgtcgtcaccggtgccgcgagtggg
attgggctcgccgtcgccacggccatggccgaagcgggggcgagcgtggtgttgtcagac
ctgcgccaggatgcggccgaagcgcaggcacaggccctgcggcagcgcggactggaggtg
acggccattgcggcggacgcctcggacgagggcgagatcgaccggctgttcacgcaggcg
gaagcgcagtatggccgcgtggatattgtcgtcaataacgcgggcatgcagcacgtggcg
cccatcgagacgtttccgacggatgtgtttcgcaagatggtggacctgatgctcacgggg
ccgttcttgagcatcaagcgggcgctgcccgggatgaaggcgcgcgggtatggtcggatt
ctcaatatggcctcgatcaacggcctcgtcgggtttgccggcaaggccgcgtacaacgcg
gcaaaacacggtctcatcggcctgacgaaggtggcggcgctcgaggcggccgagcacggt
gtgacggtgaacgcgctctgccctggctatgtggacacgccgctcgtacgcaaccagctg
gatgatctcgcccgcacgcgcaacgtccccgtggagcaggtgttggaggacgtgatttat
ccgctcgtgccgcagaagcgcttgctcgcgcccgaggaggtggcgcactacgccgtgttc
ctggcgtccgatctcgccgcgtctgtcacgggccaggccgtcgtgatggatgggggatac
gtggcgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system