KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0346Help
Entry
TC41_0346         CDS       T01821                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00480  Glutathione metabolism
aad00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TC41_0346
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TC41_0346
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TC41_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEJ42313
UniProt: F8IKC5
Position
330538..331056
Genome map
AA seq 172 aa AA seqDB search
MEQEGMTLTIYEFEVEKADGTKISMREYQGKVLLIVNTASKCGFTPQYEGLQKLYELYRE
RGFEVLAFPCNQFGNQEPGSNEEIQTFCSTTYRVTFPVFAKIDVNGPNAHPLFEHLKKEA
KGALGSETIKWNFTKFLVDREGRVVKRYAPQTSPESIREDIEACLVHASRGQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggaggggatgacgttgacgatttacgagtttgaggtggagaaggctgacggg
acgaagatatcgatgcgcgagtaccagggcaaggtgttgctcattgtcaatacggcgtcc
aagtgcggctttactcctcagtatgaaggactgcagaaattgtacgaactctatcgcgaa
cgcggcttcgaagtgcttgcctttccttgcaaccagttcggcaatcaggagccgggatcg
aacgaggaaatccaaaccttctgcagcacgacgtaccgggtgacgttcccagtcttcgcg
aaaatcgacgtgaacgggccgaacgcacatccgctgttcgaacacctgaagaaagaggct
aaaggtgcactcggatcggagaccatcaagtggaacttcaccaagtttctcgtcgaccgg
gagggtcgtgtggtgaaacgctacgcgccgcagacatcgccggagagcatccgcgaagac
atcgaggcttgtcttgtccatgcatcaaggggccagtga

DBGET integrated database retrieval system