KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0346Help
Entry
TC41_0346         CDS       T01821                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TC41_0346
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TC41_0346
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TC41_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330538..331056
Genome map
AA seq 172 aa AA seqDB search
MEQEGMTLTIYEFEVEKADGTKISMREYQGKVLLIVNTASKCGFTPQYEGLQKLYELYRE
RGFEVLAFPCNQFGNQEPGSNEEIQTFCSTTYRVTFPVFAKIDVNGPNAHPLFEHLKKEA
KGALGSETIKWNFTKFLVDREGRVVKRYAPQTSPESIREDIEACLVHASRGQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggaggggatgacgttgacgatttacgagtttgaggtggagaaggctgacggg
acgaagatatcgatgcgcgagtaccagggcaaggtgttgctcattgtcaatacggcgtcc
aagtgcggctttactcctcagtatgaaggactgcagaaattgtacgaactctatcgcgaa
cgcggcttcgaagtgcttgcctttccttgcaaccagttcggcaatcaggagccgggatcg
aacgaggaaatccaaaccttctgcagcacgacgtaccgggtgacgttcccagtcttcgcg
aaaatcgacgtgaacgggccgaacgcacatccgctgttcgaacacctgaagaaagaggct
aaaggtgcactcggatcggagaccatcaagtggaacttcaccaagtttctcgtcgaccgg
gagggtcgtgtggtgaaacgctacgcgccgcagacatcgccggagagcatccgcgaagac
atcgaggcttgtcttgtccatgcatcaaggggccagtga

DBGET integrated database retrieval system