KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0388Help
Entry
TC41_0388         CDS       T01821                                 

Gene name
rbsK
Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TC41_0388 (rbsK)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TC41_0388 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
382363..383358
Genome map
AA seq 331 aa AA seqDB search
MKDVPLYPSKLGQEPQICLESGGGGVDAVVIGSINVDLVARVQEMPGPGATVLAESARYQ
VGGKGANQAIAAARQGVRVRIIGTVGTDAFAPMLKDSLARAGVDVSGVAEVPGPSGTAII
FLEPSGQNRIVVIPGANAALSPESVERALLATEEPRETAVMLQNEIPRDAVMAAIRAAHL
RGWRVVWNVAPPSEVPAGVLRGGDVIAMNEVEAARVTGREVSDGRAAAEAAEAMLARGAG
LAIVTLGPKGVVAASARGIVHFPAWQVEVRDTTAAGDTWLGAFVAAWDGGEDVREALRYA
TAAASLCVSRMGAADSIPARSEVEAFLRSRH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagatgttcctctgtatccatcgaagctaggacaagaacctcaaatttgccttgaa
agcggaggtggcggcgtggacgcggtcgtgatcggcagcatcaacgtggatctcgtcgca
cgggtgcaagagatgccggggcctggtgcgacggtgctggcggaatcggcgcggtatcag
gtggggggcaagggcgcgaatcaggccattgccgcggcgaggcagggcgtgcgcgtgcgc
atcataggaactgtggggacagacgcattcgcgccgatgctcaaggattcgctggcccgt
gcaggcgtcgacgtctcaggcgtcgcagaggtgccggggccgagcggcacggcgatcatc
ttcctggagccgagcgggcaaaaccgcatcgtggtgattccgggcgccaacgcggccctc
tcgccggaatccgtggagcgcgccttgctcgcgacggaggagccgcgcgagacggccgtg
atgctgcagaacgagattccgcgggacgccgtgatggctgccattcgtgcggcacacctg
cgcgggtggcgcgtggtgtggaacgtggcaccgccgtcggaggtgccggctggtgtgctt
cgcggtggcgacgtgatcgcgatgaacgaggtggaggctgcccgggtgacggggcgcgag
gtgtccgacgggcgcgcggcagcagaggcggcggaggccatgctggcgcgaggggcgggg
ctcgccatcgtgacgctcggcccaaagggcgtcgtggcggcatcggcccgcggcatcgtc
cacttccctgcgtggcaggttgaggttcgcgacaccacggccgcgggggacacgtggctc
ggcgcctttgtggccgcgtgggacggcggcgaggatgtccgcgaggccctgcgctacgcc
acggccgccgcatcgctctgtgtgtcacgcatgggcgcggccgacagcatccccgcgcgc
agtgaggtggaggcatttttgcgatctcgtcactag

DBGET integrated database retrieval system