KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0576Help
Entry
TC41_0576         CDS       T01821                                 

Gene name
acs
Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aad01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aad00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aad00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aad00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:aad00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
586568..588289
Genome map
AA seq 573 aa AA seqDB search
MKGAIEHEEVVLMDDIWTVDGEDLRKLPYEAMYAKFRWPTPDRLNIAEWACRRHARVCPN
APAIWYDVDGGSAEMWTFGHLWRTTSRLAWALRDLGVPTGGRVAILLPQSPQLAAAHLAS
YAIGAIAVPLFTLFGTDALRYRLQDSGATVVVTGSEQANQIMDIRADLPDLEHVIVTDAR
VPGTQFWDDVLALASSAEYHPMDASPDDPAVLIYTSGTTGSAKGALHDHRILLGHLPGVS
LPHDFAPQPGDVFWTPADWAWIGGLYDVLLPALCWGVPVVAHRMRKFDPERAFALMERWR
VRNAFMPPTSLKMMRHITDPRSRWHLHLRTLATGGEPLGAELLSWAREALGLSIHEFYGQ
TECNLVVANCSACFPPKPGSMGRPVPGHDVAVIDENGHVVSPGVIGEIAVRRPDPVMFIG
YWNRPEETAAKFVGDWLKTGDLGRMDEEGYLWFVGRADDVITSAGYRIGPVEIEEAALQH
SAVVMAAAVGTPDPVRGEVVKLFVKLREGVPANECLTAELQNWVKERVGAHSYPREIEFV
DELPLTPSGKVRRRALREREYAQKGVPLPGKRG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgcgatcgagcatgaggaggtcgttctcatggacgacatttggacggtggat
ggggaagatctgcggaagttgccctacgaggcgatgtatgccaagtttcggtggcccacg
ccggatcggctgaatatcgccgagtgggcgtgtcgcaggcatgcgcgggtgtgcccgaat
gcgcccgctatttggtatgacgtcgacggtgggtcggcggaaatgtggaccttcggccat
ctgtggcgcaccacaagcaggttggcctgggctctgagagaccttggggttccaaccggg
ggacgggtggccatccttctcccgcagtctccccagctcgcggcggcccacctcgcctcg
tacgctatcggggcgatcgcggtacccctgttcacgctgttcggaacggacgcgcttcgc
taccggctccaggatagcggcgccacagtcgtggtcacgggcagcgaacaggcgaatcag
atcatggatatccgggccgatcttccagacctcgagcacgtcatcgtcacagacgcccgc
gttccaggcacgcagttttgggatgatgtcctcgccctcgcgtcgtctgctgaataccac
ccgatggacgcttcgcccgacgatccggctgtcctcatctacacctccggcacaaccggg
tccgcgaagggggcgcttcacgaccatcgcatcttgctcggccacctgcctggcgtcagt
ctgccgcacgatttcgcgccgcagccgggtgacgtcttctggacgcccgcggattgggca
tggattggcgggctgtacgacgtgttgctgccagccctgtgttggggtgtcccggtggtg
gcgcatcgcatgcgcaagttcgatcccgaacgtgccttcgccctaatggagcggtggcgc
gttcgcaacgccttcatgcctcccacgtccctcaagatgatgcgccatatcaccgacccc
agaagccgatggcatctacacctgcgcacgttggcgacgggcggcgaaccgctcggcgcg
gaacttctctcgtgggctcgcgaggcgttaggcctctcgattcacgagttctacggccag
acggagtgcaatctggttgtcgccaactgcagcgcatgtttcccgccgaagccgggttcc
atgggacgaccggtgccaggccacgatgtggccgtgatcgacgaaaacggccacgtggta
tctcctggcgtgatcggcgagatcgccgttcgccgtccggatccggtgatgttcatcggc
tattggaaccgccctgaggagaccgccgcgaagttcgtcggggactggctgaagacgggc
gatctcggccgcatggacgaggaaggctatctgtggttcgtggggcgcgcggacgacgtc
atcacgtcggcgggctaccggatcggcccggtggagatcgaggaggcggcgcttcaacat
tcggccgtggtcatggcggcggccgttggcacgcccgatcctgttcgcggcgaggtggtg
aagctctttgtgaaactccgtgagggcgtgcccgcgaacgagtgcctcaccgcggagctt
cagaactgggtcaaggagcgggtgggcgcgcacagctatccgcgggagatcgagttcgtc
gacgaacttcccctcacgccgtcgggcaaggtgcgccggcgagcgctgcgcgaacgggaa
tacgcgcaaaagggcgtcccgctgcccggtaagcgcggctga

DBGET integrated database retrieval system