KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0681Help
Entry
TC41_0681         CDS       T01821                                 

Gene name
fucI
Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TC41_0681 (fucI)
Enzymes [BR:aad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     TC41_0681 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688534..690342
Genome map
AA seq 602 aa AA seqDB search
MGTGRAPVPTQGVIRMQFNLKIGIRPIVDGRFGGIRESLEPITMQMAHRVGELLRTHVRK
PDGSPVECLVPDFCIGGVAEAVKADKWFASQGVAAVISVTPSWCYPLETIFRDRTIPQAI
WGFNGTERPGAVYLSAAVAALSTLGIPVFAIYGSDVQDVNDATLPADVQRKLIQFAKAAT
SVAAMKDKSYLSVGYVSMGIAGCLIDESFFSDYLGMRVEYVDMTEFVRRIERGIFDPDEL
ERALKWVQKYCKEGDDRNPPAERRSKAQKDRDWEFVVKMTLIMKDLIEGNDRLKGLGYPE
ESFGHAAIAAGFQGQRSWSDHFPISDFMESILCSSFDWNGPRRPYIVATENDSLNAVSML
FGYLLTGTAQIFADVRTYWSPESIQRATGWKPTGQSENGFLHLINSGPAALDGTGAATRD
GKPVIKPFWEMTEQDIESCLESVTWCPAYDYFKNGGFSCRYVTKGGMPVTIIRLNRIRGV
GPVLQLAEGYTIDLPPEVSRTIDERTNPTWPSTWFVPKLTGSGAFESVYTVMDNWGSNHC
AICYGHIGSELITLASMLRIPVPMHNVESSRIFRPRVWSQFGHDDGIGADFRACAAFGPL
YA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacaggtcgagcacctgtgcccacgcaaggagtgatcaggatgcagttcaacttg
aagatcggcattaggccaatagttgatggtcgcttcggaggtattagagaaagcctggaa
cctattaccatgcaaatggctcatcgtgtgggtgagctgctccgcacgcatgtacgcaag
ccagacggaagccccgtcgagtgccttgttcctgatttttgcattggaggggtcgctgaa
gctgtaaaggcggacaagtggtttgcttctcagggcgtcgcggcagtgatttcggtaact
ccgtcttggtgctatccgcttgagacaatttttagagatagaacaattccgcaagcgata
tggggcttcaatggtacagaacgcccaggagcggtttacttgtccgcagcggttgctgca
ctgtcgactttaggtataccggttttcgcaatatacggttcggacgtacaagatgtgaat
gatgcgactttaccggccgacgtacagcgaaagctaatacaatttgctaaggcggctacg
tctgtggcagcaatgaaagataagtcatacctgtcggtcggatacgtgtcgatggggatc
gcgggttgcctgatcgacgaatcgttctttagtgattatttgggcatgagagtcgagtat
gtggatatgacggagtttgtgcgcagaatagaacgggggatttttgatcccgatgagttg
gagcgggcgcttaagtgggtacagaagtattgcaaagagggagatgaccgaaatcctccc
gcggagcgacgtagcaaagctcagaaggatagggattgggagttcgttgtgaaaatgacc
ctcatcatgaaggatttgatagaagggaatgatagactgaaagggctcggttacccagaa
gagtctttcgggcatgcggctatcgcggccgggtttcagggtcaaagatcttggagtgac
cactttccaattagcgattttatggagagcatcctatgttcgtccttcgactggaacggg
cccaggcgtccttacatagtggcgacggagaatgattcgttaaatgcggtatccatgcta
ttcggatatctactcacaggaacagctcaaatatttgcagatgttcgaacctactggagt
ccagaaagtattcaaagggcaacaggatggaagcctactggccaatcggaaaatggattt
ctacacctcatcaattcagggccagctgcgttggatggcaccggcgctgcaactcgagat
ggcaagccggtcataaagccattctgggagatgacggaacaggacatcgaatcctgtcta
gaatcggtgacttggtgtcctgcctatgactatttcaagaatgggggattttcttgtaga
tatgtaacaaaaggtgggatgccagtaaccattatacggttgaataggattcgtggagta
ggtcctgtgcttcaattggcagagggttacacgatcgatcttccacctgaggtaagtcga
actatcgacgaacgaaccaatccgacgtggccaagtacgtggtttgtgccgaaattaacc
ggcagtggcgcctttgagtcggtttatacggtgatggacaattgggggagcaatcattgc
gcgatatgttatggacatatcggttcggaactcatcaccctagcgtcgatgttgagaatc
ccagtgcccatgcataatgtagagagctcgagaatcttcaggccgagagtttggtcacag
tttggtcacgacgacggcatcggggctgatttccgagcctgtgctgcatttggtccgctg
tacgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system