KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0697Help
Entry
TC41_0697         CDS       T01821                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TC41_0697
Enzymes [BR:aad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TC41_0697
   3.1.2  Thioester hydrolases
    3.1.2.-  
     TC41_0697
Lipid biosynthesis proteins [BR:aad01004]
 Fatty acid synthase
  Component type
   TC41_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(702759..703562)
Genome map
AA seq 267 aa AA seqDB search
MPTKNMKRRRVAASLGACAIACAVSACGTHPAKNAPTAPESAQSAARQTSPYPLFSHPSA
QPVVAMGVGGSVAHGWDDKTGGGYLVRAFQELTKTGPITFQFINKSIEGYGPTQMAAKYP
EFLREVHPQVVVISWGMLDDIANKTPISAFEQAVQSEIQQALAAHADVIVVTPPPTGASY
GHDQTSESQLVADEIRVAKQFKTPDVIVVDLFNQMKRYLAAHHQSIQMYSADDWHPNTLG
HELAGSLLAQDLQGTLVPAASAKPSSG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaaaaacatgaaaaggcgccgcgtcgcggcgtcgctcggcgcatgcgccatc
gcctgtgcggtcagcgcctgcgggacccatcctgccaaaaacgcgcccacggcgcccgag
agcgcgcagtcggcggcgcgacagacgagtccttatcccctcttctctcatccatccgcg
cagccggtcgtcgcgatgggcgtcggcggctcggtcgcgcacggatgggatgacaagacc
ggcggtggctatctggtgcgggcgtttcaggaactgacgaagaccggccccatcaccttt
cagttcatcaacaaatccatcgaaggatacggccccacgcagatggcggccaagtatccc
gaatttctccgcgaagtccatccccaggtagtcgtcatctcgtggggcatgttggatgac
atcgccaacaagacgcccatctccgcattcgaacaggccgttcagtctgaaattcaacag
gccctcgctgcgcacgcggacgtgatcgtcgtgacgccgccgccgaccggcgcatcctac
ggccacgaccaaacgtcggagagccagctcgtggccgacgaaattcgggtggcaaagcaa
ttcaagacgccggacgtgattgtcgtggatctctttaaccagatgaagcgctacctcgcg
gcccatcaccagtcgattcagatgtacagcgcggacgactggcaccccaacacgctcggc
catgaattggcgggatcgcttttggcccaggatctgcagggcacactcgtgcctgccgcg
agcgccaaaccgagctcaggatga

DBGET integrated database retrieval system