KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0714Help
Entry
TC41_0714         CDS       T01821                                 

Gene name
tpiA
Definition
(RefSeq) Triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TC41_0714 (tpiA)
   01230 Biosynthesis of amino acids
    TC41_0714 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_0714 (tpiA)
   00051 Fructose and mannose metabolism
    TC41_0714 (tpiA)
   00562 Inositol phosphate metabolism
    TC41_0714 (tpiA)
Enzymes [BR:aad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TC41_0714 (tpiA)
Exosome [BR:aad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TC41_0714 (tpiA)
  Exosomal proteins of bladder cancer cells
   TC41_0714 (tpiA)
  Exosomal proteins of melanoma cells
   TC41_0714 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724859..725629
Genome map
AA seq 256 aa AA seqDB search
MARTPLLMGNWKMYKTVAEARAFAEALGQQSQKLDRRVEYAICAPYTCLHVLRVMLPAQV
RLGAQNVFPEKEGAYTGEIAPGMLAEFGTKYVLAGHSERRMLFGESDQFINQKVKAIVAN
GMTPVLCVGENSSQKEDGVTKEVVTGQVLQGLDGLSADEVASAVVAYEPVWAIGSGKTAT
PEDAQEVARAIRAAVAETWSDQAAEGLRILYGGSVKPENVASFVREPDLDGALVGGASLD
PVSFAAMAEAIKEVLA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggacgccccttctcatgggcaactggaagatgtacaagacggtggcggaggcc
cgggctttcgcggaggccctcgggcagcagtcgcagaagcttgaccgccgggtcgagtac
gccatttgtgcgccgtacacctgtttgcacgtcctgcgcgtgatgttgccggcccaggtg
cgcttgggagctcagaatgttttcccagaaaaggaaggtgcgtatacaggcgagattgcc
ccgggtatgcttgccgagttcgggacgaaatacgtcctggctggacactcagagcgccgg
atgctgttcggcgagtcggatcagttcatcaatcaaaaggtgaaggccatcgtggcgaac
ggcatgacaccggttctgtgtgttggcgagaactcgtcgcagaaggaggacggcgtgacc
aaggaagtggtcacgggtcaggtgctgcaggggctcgacggtctcagcgcagacgaggtg
gcgagcgcggtcgtcgcgtacgagccggtctgggccattgggtccggcaagacggccacg
cccgaggacgcgcaggaagtcgcgcgggcgattcgcgcggccgtggcggagacctggtcg
gaccaagctgccgaggggcttcgcatcctgtacggcggcagcgtgaagcctgaaaatgtg
gcgtcgttcgtccgtgagcccgatctcgacggggcgctggtgggcggcgccagcctggat
cccgtgtcgttcgcggcgatggcggaagccattaaggaggtgctcgcatga

DBGET integrated database retrieval system