KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0714Help
Entry
TC41_0714         CDS       T01821                                 

Gene name
tpiA
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00010  Glycolysis / Gluconeogenesis
aad00051  Fructose and mannose metabolism
aad00562  Inositol phosphate metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
aad01230  Biosynthesis of amino acids
Module
aad_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aad_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_0714 (tpiA)
   00051 Fructose and mannose metabolism
    TC41_0714 (tpiA)
   00562 Inositol phosphate metabolism
    TC41_0714 (tpiA)
Enzymes [BR:aad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TC41_0714 (tpiA)
Exosome [BR:aad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TC41_0714 (tpiA)
  Exosomal proteins of bladder cancer cells
   TC41_0714 (tpiA)
  Exosomal proteins of melanoma cells
   TC41_0714 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Spo0A_C
Motif
Other DBs
NCBI-ProteinID: AEJ42672
UniProt: F8IEF8
Position
724859..725629
Genome map
AA seq 256 aa AA seqDB search
MARTPLLMGNWKMYKTVAEARAFAEALGQQSQKLDRRVEYAICAPYTCLHVLRVMLPAQV
RLGAQNVFPEKEGAYTGEIAPGMLAEFGTKYVLAGHSERRMLFGESDQFINQKVKAIVAN
GMTPVLCVGENSSQKEDGVTKEVVTGQVLQGLDGLSADEVASAVVAYEPVWAIGSGKTAT
PEDAQEVARAIRAAVAETWSDQAAEGLRILYGGSVKPENVASFVREPDLDGALVGGASLD
PVSFAAMAEAIKEVLA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggacgccccttctcatgggcaactggaagatgtacaagacggtggcggaggcc
cgggctttcgcggaggccctcgggcagcagtcgcagaagcttgaccgccgggtcgagtac
gccatttgtgcgccgtacacctgtttgcacgtcctgcgcgtgatgttgccggcccaggtg
cgcttgggagctcagaatgttttcccagaaaaggaaggtgcgtatacaggcgagattgcc
ccgggtatgcttgccgagttcgggacgaaatacgtcctggctggacactcagagcgccgg
atgctgttcggcgagtcggatcagttcatcaatcaaaaggtgaaggccatcgtggcgaac
ggcatgacaccggttctgtgtgttggcgagaactcgtcgcagaaggaggacggcgtgacc
aaggaagtggtcacgggtcaggtgctgcaggggctcgacggtctcagcgcagacgaggtg
gcgagcgcggtcgtcgcgtacgagccggtctgggccattgggtccggcaagacggccacg
cccgaggacgcgcaggaagtcgcgcgggcgattcgcgcggccgtggcggagacctggtcg
gaccaagctgccgaggggcttcgcatcctgtacggcggcagcgtgaagcctgaaaatgtg
gcgtcgttcgtccgtgagcccgatctcgacggggcgctggtgggcggcgccagcctggat
cccgtgtcgttcgcggcgatggcggaagccattaaggaggtgctcgcatga

DBGET integrated database retrieval system