KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0766Help
Entry
TC41_0766         CDS       T01821                                 

Gene name
galA
Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aad00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aad00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780859..783090
Genome map
AA seq 743 aa AA seqDB search
MANGKGRTSMPIIFHSDERLFHLLTPRSSYVIRVGDQGTLEHVYWGARLEDASDLVRIAR
ACQRLDARPEHMRATDIGSLRLEYPSFGTGDHRDPAYEVLQPSGSHASQLVYESHQIRPG
KPALPGLPAFYVESDFEADTLEISLVDPAISLRVILSYTVYRDFDLVCRHARFENAGTEP
LVLRRALSASVDLDLRQADFVQLSGAWIRERFIERTSLSPGRHEIMSRSGASGHKHNPFF
ALAAPHTTEDCGEVRAFALVYSGNFIGACEMEPMRQNVRAQIGIHPADFAWRLEPGERFV
TPEAVLVYSDEGWGGMSRTFHRAIRMRLCRGTYRDAVRPVLINNWEATYFQFDEDDLVEI
AEQARDLGVELFVLDDGWFGQRDDDTTSLGDWWPHPRKLPHGLRHLADRIHALGLQFGIW
MEPEMVSPKSELYREHPDWCLHVADRPRSERRHQLMLDLTREDVRAFVVDAVSRVIEEGA
VDYIKWDMNRPMTEVGSAALPPERQREVAHRYVLGLYEILETLTSRFPHVLFENCASGGG
RFDLGMLHYMPQTWTSDNTDAVSRLKIQHGTSLVYPPVAMGAHVSAVPNHQMGRVTPFAL
RAGVAMCGNFGFELDPRRLSDAERREARQAVERYKALRQLVQFGDFYRLLSPFDGPEAAW
MFAAEDGSEALVAYFCTYPDPMDPPARLALRGLRPEARYVCEALGESFRGDALMRHGLII
PRHMGDGQAVLIHLKQIGEGDGP
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaatgggaagggacgaacttcgatgcccatcatctttcattcggatgagcgcctg
tttcacctgctgacgccgagatcgagctacgtgattcgcgtcggcgaccaaggcacattg
gagcacgtctactggggcgccaggttggaagacgcgtcggatctggtccgcatcgcgcgc
gcctgccagcggcttgacgcgcggccggagcacatgcgcgccaccgacatcggctcgctt
cgccttgagtatccctcgttcgggacgggcgaccaccgcgatcccgcctacgaggtcttg
cagccgtccggcagccacgcgtcccagctcgtgtacgagtcgcaccagatccgacctggc
aagccggcgcttccgggcttgcccgcgttttacgtcgaatccgatttcgaagccgacacg
ctcgagatctcgctggtcgatccggccatctcgctgcgcgtgatcctctcctacaccgtc
taccgcgacttcgatcttgtctgccgccacgcgcgtttcgagaacgcggggactgaaccg
ctcgtcctgcgccgggcactctccgcatctgtcgatctcgacctgcggcaggcggacttt
gtccaactgtccggcgcctggatccgcgagcggtttatcgagcggacgtcgctttcgcct
gggcggcatgagattatgagccgctccggcgcgagcggccacaagcacaacccgttcttc
gccctcgcggcgccgcatacgacggaggactgcggcgaggtgcgcgcgttcgccctcgtc
tacagcggcaacttcatcggcgcctgcgaaatggagcccatgcggcaaaacgtgcgcgcg
cagatcggcatccatcccgccgacttcgcctggcgcctcgaacccggcgagcggtttgtc
acgcccgaggccgtgctcgtgtactcggatgagggatggggtggcatgtcgcgcacgttc
caccgcgccattcgaatgaggctgtgccgaggcacttatcgcgatgccgtccgccccgtg
ctcatcaacaactgggaagcgacgtatttccagttcgacgaggacgatctcgtcgagatc
gccgagcaggcgcgcgatctcggcgtggagctgttcgtcctcgacgacggctggttcggc
cagcgcgacgacgataccacgtcgctcggcgattggtggccgcacccccgcaaactcccg
cacgggctgcgccatctcgccgatcgcatccacgcgctcggactccagttcggcatctgg
atggagccggagatggtgtcgccgaagagcgagctgtatcgcgagcatccggattggtgc
ctgcacgtggcggatcggccgaggtcggagcgaaggcatcagctgatgctcgatctcacg
cgcgaggatgtgcgcgccttcgtggtggacgcggtgtcgcgcgtgatcgaagaaggggct
gtcgattacatcaaatgggacatgaatcggccgatgaccgaggtcggatcggccgcgctc
ccgccggagcgccagcgcgaggtcgcgcaccgctacgtgctcgggctgtacgagatcctg
gagacgctcaccagccggtttccgcacgtgctgtttgagaattgtgcctccggcgggggc
agattcgatctcggcatgctccactacatgccgcagacgtggacgagcgacaacacggac
gccgtctcgcggctgaagattcagcacggcacgagcctcgtctatccgccggtggcgatg
ggcgcgcacgtgtcggccgtgcccaaccaccagatggggcgcgtgacgccgttcgccctt
cgcgccggcgtcgcgatgtgcggcaacttcggcttcgagctcgatccgcggcgcctttcg
gacgcggagcggcgcgaggcgcgtcaagcggtggagcggtacaaagcgcttcgccagctc
gtgcagtttggggacttctatcggctgctgtcgccgtttgacgggcccgaggcggcctgg
atgttcgccgccgaggacggtagtgaggcgctcgtcgcctatttttgcacgtacccggat
cccatggatccgccggcgcgcctcgccctgcgcggcctgcggcccgaggcgcgctacgtc
tgcgaggcgctcggcgagagctttcgcggcgacgcgctcatgcgccacggcctcatcatt
ccgcgccacatgggcgacgggcaggccgtgctgattcatctcaagcaaatcggggaaggt
gatggcccgtga

DBGET integrated database retrieval system