KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0801Help
Entry
TC41_0801         CDS       T01821                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00360  Phenylalanine metabolism
aad00362  Benzoate degradation
aad00620  Pyruvate metabolism
aad00621  Dioxin degradation
aad00622  Xylene degradation
aad00650  Butanoate metabolism
aad01100  Metabolic pathways
aad01120  Microbial metabolism in diverse environments
aad01220  Degradation of aromatic compounds
Module
aad_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TC41_0801 (mhpF)
   00650 Butanoate metabolism
    TC41_0801 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TC41_0801 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TC41_0801 (mhpF)
   00622 Xylene degradation
    TC41_0801 (mhpF)
   00621 Dioxin degradation
    TC41_0801 (mhpF)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TC41_0801 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA LZ_Tnp_IS481
Motif
Other DBs
NCBI-ProteinID: AEJ42758
UniProt: F8IEX5
Position
824069..824968
Genome map
AA seq 299 aa AA seqDB search
MRKLQAAIVGSGNIGTDLMIKLLRSPWLEPRWMIGIDPESNGLRCAAKLGLETSAEGLKA
VLDRGARPDVVFDATSAKAHVRHAKLLREAGIQAIDLTPAARGPYVIAAVNLKEHLDSPN
VNMVTCGGQATVPMVYAVSRIVPVRYAEIVATIASKSAGPGTRQNIDEFTQTTARALETI
GGAKRGKAIIILNPAEPPILMRDTVYCMIEDASKPVVDRVIESIHDMVRHVQTYVPGYRL
NRDPIVMDNVVSISLEVEGLGDYLPVYAGNLDIMTAAAVKFGEEYAKHRLAAEGVEIAQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaattgcaggccgccattgtgggatcgggcaatattgggaccgatctgatgatc
aagttgctgcgaagcccgtggttggagccgcgctggatgatcgggatcgacccggagtcg
aacgggctgcgctgcgccgcgaagctcggacttgagacgtccgctgaagggctcaaggcc
gtgctcgatcgcggcgcgaggccggacgtggtgtttgatgccaccagtgcgaaggcccac
gtgcgccacgcgaagctgttgcgcgaagcgggcattcaggcgatcgatctcacgccagca
gcgcgcgggccatacgtgatcgcggcagtcaacctcaaggagcacctcgattcgccaaac
gtgaacatggtgacgtgcgggggccaggccacggtgccgatggtgtacgcggtgagccgg
atcgtgccagtgcgatacgccgagattgtggcgaccatcgcgagcaagagtgcaggcccg
gggacgaggcagaacatcgatgagttcacgcagaccaccgcgcgagcgcttgaaaccatc
ggcggggcgaagaggggaaaggccatcatcatcctgaaccccgccgagccaccgattctc
atgcgagacacggtgtactgcatgatcgaggacgcgtccaagcccgtggtggaccgcgtg
atcgagtcgatccacgacatggtccgccatgtgcagacctacgtgcccggatatcgactg
aaccgcgatcccatcgtgatggacaacgtggtcagcatctcgctcgaggtggagggactg
ggggattacctcccggtctacgccgggaacctggacatcatgacggcagcggcggtcaag
tttggagaagagtatgcgaagcacaggctggcggcggagggagtggagatcgcgcaatga

DBGET integrated database retrieval system