KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1364Help
Entry
TC41_1364         CDS       T01821                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00900  Terpenoid backbone biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
Module
aad_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TC41_1364 (dxr)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TC41_1364 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh Epimerase
Motif
Other DBs
NCBI-ProteinID: AEJ43301
UniProt: F8IIG9
Position
1338138..1339289
Genome map
AA seq 383 aa AA seqDB search
MKRIAILGSTGTIGVQALDVLSQLDTYEVVALAAGRNVQRLAEQIRRYRPKLVGVADEAA
RRALLELLPGEQVDIVVGDEGLVACAAYPSDVVLNAVVGARGILPALAAVGRGARLALAN
KECLVAAGDLILRAMQDAGGEIVPVDSEHCALHQCLRSGRPEEVLQLVLTASGGPFRSWP
KARMAEVTVRDALRHPNWNMGQKITIDSATMMNKGLEVIEAHHLFAVPYDKIAVLVHPES
IVHSMVEFVDGSVVAQLATADMRLPIQYAVTYPERLAAPWPRLNLAGVGALHFEEPDLDK
FPCLRLAVEAGRAGGIAPCVLNAANEVAVDAFLHEKIPFLRIPEVVEAVLERLPNEAPQS
VDDILRADAQARRLAEFYVAKGG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcatcgccattttggggagcacgggcaccattggagtgcaggcgctcgacgtg
ttgtcccagttggatacatacgaggtcgtcgcgcttgcggcggggcgcaatgtgcagcgg
ttggcggaacagattcgccgataccgcccgaagctcgttggcgttgccgacgaggcagcc
cggcgcgcgctgctcgaactcttaccgggtgaacaggtggacatcgtcgtcggagacgag
gggctcgtcgcctgtgccgcgtatccgtcggatgtggtgctgaatgcggtggtgggggcc
cgggggattctgcctgcgcttgctgcggtcggccgcggcgcgcggctggcgctcgccaac
aaggagtgccttgtggcagcgggagatctgatccttcgcgccatgcaagacgcaggcggc
gagattgtcccagtggacagcgaacactgcgcccttcaccagtgtctgcgatccggcagg
cccgaggaggtcctgcagctcgtcctcaccgcttcgggaggccccttccgctcctggccg
aaggcgcgcatggcggaggtcacagtccgcgatgctctgcgccatccaaactggaacatg
ggccagaagatcaccatcgacagcgccacgatgatgaacaaggggctcgaggtgattgag
gcgcatcatttgtttgccgtgccatatgataagatagctgtgcttgtacatccggaaagc
atcgtgcactccatggtggagtttgtggacggctcggtggtggcacagctcgcgacggcc
gacatgcgcttgcccattcagtacgccgtgacgtatcctgagcgcctcgccgcgccttgg
ccgcggctgaacctggcgggtgttggagcacttcacttcgaggaacccgatctcgacaag
tttccctgcctgcgtctcgccgtcgaggcgggccgcgcaggcggcatcgcgccctgcgtc
ctgaacgcggcgaacgaagtggcggtcgacgcgtttttacatgaaaagatcccgtttttg
cggatccctgaggttgtggaagcggtgctggaacgcttgccgaacgaagcccctcagtct
gtcgacgatatccttcgcgcggatgcacaagctcggcgtctagctgaattctacgtggca
aagggcggatga

DBGET integrated database retrieval system