KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1564Help
Entry
TC41_1564         CDS       T01821                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00260  Glycine, serine and threonine metabolism
aad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
aad01230  Biosynthesis of amino acids
Module
aad_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TC41_1564 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TC41_1564 (trpB)
Enzymes [BR:aad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TC41_1564 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEJ43495
UniProt: F8IJY3
Position
complement(1538343..1539557)
Genome map
AA seq 404 aa AA seqDB search
MSHYPYPDETGRYGAFGGRYVPETLMSALLQLERDYLRLSRDESFQAELKYYLEQYAGRP
TPLYYAERLTKHLGGPKIYLKREDLNHTGAHKINNAIGQALLALRTGKRRVIAETGAGQH
GVATATVAARFGLECTVFMGEEDMRRQALNVFRMRMLGAEVVAATSGTRTLKDATNEAIR
HWVAHVDDTHYIIGSVVGPHPYPMIVRDFQRVIGDEAKAQILQQEGRLPTSVVACVGGGS
NAMGIFYPFIEEEGVELIGCEAAGRGLETPYHAASIARGRPGVLHGAKTMLLQDEYGQVQ
PAHSISAGLDYPGIGPEHAHLAATGRATYVPVTDDEALEAFFLLSKLEGIIPALESAHAI
AYLMREADRYSSDDVVVVCLSGRGDKDVEQVAAREGDEAHGSHP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattatccatatcctgatgaaacggggcgatatggcgcgtttggcgggcgttac
gtcccggagacgctcatgtcagctctcctccaattggaacgcgattacctgcgcctctcg
cgcgacgaatcgtttcaagcggaactgaagtattatcttgagcaatacgcgggcaggccg
acgccgctctattacgcggagcgcctgaccaagcaccttggtgggccgaagatctacctc
aagcgggaagacctgaatcacaccggcgcccacaagatcaacaacgccatcggtcaagcg
ctgctcgcgcttcggacagggaagcggcgcgtgatcgcagagacgggcgcgggccagcac
ggggtcgcgacggcgacggtggccgcgcggtttggcctggaatgtaccgtgttcatgggc
gaagaggacatgcgccggcaggcactgaacgtgtttcgcatgcggatgctcggcgccgaa
gtggtggcggccacctcagggacgaggacgctgaaggacgccacgaacgaagccattcgc
cactgggtcgctcacgtggacgacacgcactacatcattgggtccgtggtgggccctcat
ccgtatccgatgatcgttcgcgattttcagcgggtgattggggatgaggcgaaggcgcag
atccttcagcaggaaggccgcctgccgaccagcgtggtggcgtgcgtcggtggcggatcg
aatgctatggggatcttttacccctttattgaagaggagggcgtggagctcatcggctgt
gaagccgcgggacgcgggctggagacgccctatcacgcggcgagcatcgcgcgcgggcgc
ccgggcgtgttgcacggagcgaagaccatgctgttgcaggatgaatacggtcaggtccaa
cccgcccattccatttcagcgggactcgactaccccggtatcggccctgagcacgcacat
ctggctgccacggggcgcgccacgtatgtgcccgtgacggacgacgaagccctcgaggca
ttttttctcctgtcgaaactcgaaggcatcattccggcgctcgagagcgcacacgccatc
gcgtatctgatgcgggaagcggatcggtacagttccgatgacgtcgtcgtcgtctgcctc
tccggccgcggcgacaaagacgtcgaacaggtggccgctcgggagggagatgaagcgcat
ggatcgcatccgtga

DBGET integrated database retrieval system