KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1566Help
Entry
TC41_1566         CDS       T01821                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TC41_1566 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TC41_1566 (trpC)
Enzymes [BR:aad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TC41_1566 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1540230..1541033)
Genome map
AA seq 267 aa AA seqDB search
MSTILDRILETKRREVEALHDRVVREGPFPERTDPFRSLAQALREARRLCVIAEIKRKSP
SKGVFQASVDPAERAKVYEQGGACAISVLTDETYFHGALEDLRAARSAVQLPVLRKDFVI
DEIQIDEAVSAGADLLLLIAAAMPEQRLVELSRYARDRGLEVLLEVHGEEEVEAALAAEP
TLIGINNRDLRTFEVDLATSERVLRRLPEGTLAIAESGIMGRDDALRMASAGARGILVGE
LLMRHADLASVRAQVADLCVPLEAVAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccatcttagaccggattctcgagaccaagcgccgagaagtggaagcgttgcac
gatcgcgtcgttcgtgaagggccttttccggaacgaacggacccgtttcgctcgctggct
caggcgttgcgcgaggctcgccgtctttgtgtcatcgcggaaatcaagcgcaagagcccg
tccaaaggcgtgttccaggcgagcgtggatcccgccgagcgcgccaaggtgtacgagcag
ggcggcgcttgcgccatctccgtcttgacggacgagacgtattttcatggggcgcttgaa
gatttgcgagcagcccgctcggcagtccaacttcccgtgctgcgcaaggacttcgtgatt
gacgagatccagatagatgaggcggtttcggcaggggcggatctcctgttgctgatcgcc
gcggccatgcccgagcaacgtttggttgaattgtctaggtacgcgcgcgatcggggactc
gaggtgctgcttgaagtgcatggcgaggaggaggtggaggccgctttggcggccgagccg
accttgattggcatcaacaatcgcgatctgcggaccttcgaggtggatctcgccacgtcg
gagcgggtcctgcggcggctgcccgaagggacgctcgccatcgccgagagcggcatcatg
ggccgagacgatgccctgcgcatggcgtctgcgggcgcgagggggattttggtcggtgaa
cttctgatgcgccacgcggatctcgcatccgttcgagcgcaggtggcggatctatgtgtc
ccgcttgaggcggtggcgaagtga

DBGET integrated database retrieval system