KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1571Help
Entry
TC41_1571         CDS       T01821                                 

Definition
(GenBank) peptidase M42 family protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1544946..1545914)
Genome map
AA seq 322 aa AA seqDB search
MRLMDFVAPSGSEAAVVQALLDHVRDAADETWVDALGNGMARKRGEGPHLMLAAHVDEPG
IMVMDIDDRGYLRVVSVGDAQARECVGRLVRFTNGTEGLVHADPSAKGDLDFDALVVDVG
AQSREEAERMVPIGTAGAVHVPPVTWGNDMVTGRAVDNRLGCAVAAEVFHKLAARGLNVS
IAFTAQNAVGARAAQAAAFQLEPQYALVIDGVTADDVWHDDPAVSLGKGPVLKVMDRATV
VPLDGKRAVERAADGLHLALQHEVSRDAWSDTGAIQLAKTGCMAIGLGYPVRRAGAFAAT
ADVSDAKRLVDLAVATAETLLG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgatggacttcgttgcaccgagcgggagtgaggcggccgtggtccaggcgctc
ttggatcacgtccgagacgcggcggacgagacctgggtggacgcgcttggcaacgggatg
gcgcgaaagcggggcgaggggcctcacctcatgctggccgcgcacgtcgacgagcctggc
atcatggtcatggacatcgacgaccgcggttatctccgcgtggtctccgtcggagacgcg
caggcgcgcgagtgcgtcggacggttggtccgtttcaccaatggcacggaggggctcgtc
cacgcagatccgtcggcaaagggcgatctcgactttgacgctctggtcgtcgacgtcggg
gcgcaatcgcgcgaagaggccgagcgcatggtgcccattggaacagccggtgcggtacac
gttcctcctgtgacgtggggaaatgacatggttacggggcgcgccgtcgacaaccgcctg
gggtgcgctgttgccgcggaggtgtttcacaagctcgccgcaagagggttgaacgtaagt
atcgcgttcacggcgcagaacgcggttggggccagggccgcgcaggctgcggcctttcag
ctcgagccccagtacgcactcgtgatagacggcgtgacagcagacgacgtgtggcacgat
gacccggccgtatcgttgggcaagggacccgttctgaaggtaatggatcgcgcgaccgtg
gtgccgctcgatggcaagcgcgctgtggaaagagcagcggatggattacacctggcgctt
caacacgaggtgtcgcgcgatgcatggagcgacacgggcgcaattcaactggcaaagacg
ggttgtatggccatcgggctcgggtatcccgtgcgtcgcgcgggggctttcgccgcgacg
gcggacgtgtcggacgcgaagcgtctggtggatctcgccgtggcgacggcggagactctc
ttaggctga

DBGET integrated database retrieval system