KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2177Help
Entry
TC41_2177         CDS       T01821                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TC41_2177
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_2177
   00620 Pyruvate metabolism
    TC41_2177
   00640 Propanoate metabolism
    TC41_2177
  Energy metabolism
   00680 Methane metabolism
    TC41_2177
Enzymes [BR:aad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TC41_2177
Lipid biosynthesis proteins [BR:aad01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TC41_2177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2069586..2071559)
Genome map
AA seq 657 aa AA seqDB search
MADEVLSMIANARLIPPPEAYAARSYLSSYEEYRARYQASIDDPAAFWDEIADELVWQQR
GKTVIAGELPDFQFFPGSYINVCENCVDRHAKHPMYRNKVALFFEGEDGERRSVTYLQLQ
DAVSRFANALQDLGLRQGDVVCVYMQNLIETYVALLACLRIGVLYNTVFAGFSAEALRER
IVRCGAKAVICANGSLRRGKVLRLKETVDRAFEGVETVEHVIVYRRLPDLDTPMTPGRDL
DFESLVEGASRDCPPALLEANEPAFLIFTSGTTGRPKGIVHAGGGFLLGTYAYTKYQLDL
RPEDVYWNTADIGWLTSHIFVLVGGLALGTTTLLYEGALDWPKPGRLYEMIERYRVNKLF
SAPTAYRMMMKHGEDIARQYDLSSLQLLVSVGEPFNPEAWHWVRRVVGGDVAVINNTWGQ
TETGGTPLALLPGAVPMKPGSCGVPFFGHDLAVVDEEGREVPDGVPGYLVIRCPFPSLAR
DVYGDRSLYLNAYFSRMPGLYFTGDSAVRDADGHFWVLGRVDDVINVSGHRISTMEMESS
LIQHPAVVEAAVVGEPDDVKGQVPVAFVTLERGWEPKSDLEAELKARVVADIGSFARPAR
VYFVEAMPKTRSGKILRRMLREILQTGEVKGDVTGLEDWEVVERLLHDLRERAPGGE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacgaagtgttgagcatgattgcgaacgcaaggctgatcccgccaccggaggcc
tacgcggctcggtcgtatctctcgagctacgaagagtaccgggcgagatatcaggcgtcc
atcgacgatccggcggcattctgggacgagatcgccgacgagttggtctggcagcagcgc
gggaagacggtcatcgcgggcgagcttcccgactttcagttttttcccggcagctacatc
aacgtctgcgagaactgcgtggatcggcacgcgaagcatccgatgtaccgaaacaaggtg
gcgctcttcttcgagggggaggacggcgagcgccgcagcgtcacgtacctccagctccag
gatgccgtgtcccggtttgcgaacgcgctccaagatctcgggctgcgccagggcgacgtg
gtctgcgtgtacatgcagaatctcatcgagacctacgtcgcgctcttggcgtgtctgcgc
atcggcgtgctctacaacacggtgtttgcggggttctccgccgaggcgctgcgcgagcgg
attgtgcggtgcggcgcgaaggccgtcatctgtgccaacggcagcctcaggcgcggcaag
gtgctgcggttgaaggaaaccgtcgatcgggcgtttgaaggcgtggagacggtggagcac
gtgatcgtctaccgacgcctgccggatctcgacacgccgatgacgccggggcgcgatctc
gactttgagtcgctcgtcgagggcgcatcccgggactgcccgccggccctgctggaggcg
aacgagcctgcgtttctcatcttcacgagcgggaccaccggtcgccccaaaggcatcgtc
cacgccggcggaggatttctgctcggaacctacgcgtacacgaagtaccagctcgacctc
cgacccgaggacgtgtactggaacacagcggacatcggctggctgacatcccacatcttc
gtcctggtcggcggcctcgccttaggcaccacgaccctcctgtacgagggcgcgctcgat
tggccgaaaccgggcaggctatacgagatgatcgagcgataccgcgtcaacaaactgttc
tcggcacccaccgcctatcggatgatgatgaaacacggcgaggacatcgcgcggcaatac
gacctgtcgtcgcttcagctcttggtgtcggtcggagagccattcaatcccgaggcgtgg
cactgggtccgccgcgttgtgggcggtgacgtcgctgtaatcaacaacacctggggccag
accgagaccggtggaacgccgctcgcgctgttgcccggcgcggtgccgatgaagcccggc
tcgtgcggcgtgccgttctttgggcacgatctcgccgtggtggatgaagagggccgagag
gtgccggacggtgtgcctggataccttgtcatccgctgtccgttcccgtctcttgcacgc
gacgtgtacggcgatcgaagcctctatctgaacgcgtacttctcgcgcatgccaggcctt
tacttcaccggcgacagcgcggtgcgggatgcagacggccacttctgggtgctcggccgg
gtcgacgacgtgatcaacgtgtcgggccaccgcatcagcaccatggaaatggagagttcg
ctcatccagcatccggccgtggtggaggcggcggtcgtgggcgagcctgatgacgtgaag
ggacaggtcccggtggcgttcgtgaccctcgagcgcgggtgggaaccaaagagcgacctg
gaggcggaactgaaggcgcgcgtcgtggcggacatcggttcgtttgcgcggccggcgcgc
gtgtatttcgtggaagcgatgccgaagacgcgatcgggcaagatcctgcggcggatgctg
cgcgagattttgcagaccggcgaagtgaagggagacgtcaccggcctggaggactgggag
gtcgtggaacggcttttgcacgatctgcgcgagcgggcgccgggcggtgaatga

DBGET integrated database retrieval system