KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2193Help
Entry
TC41_2193         CDS       T01821                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TC41_2193 (galU)
   00052 Galactose metabolism
    TC41_2193 (galU)
   00500 Starch and sucrose metabolism
    TC41_2193 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TC41_2193 (galU)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TC41_2193 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2085655..2086572
Genome map
AA seq 305 aa AA seqDB search
MRNIAEVKHMKVRKAVIPAAGFGTRMLPATKAVPKEMLPILNKPCIQYIVEEAVYSGIEE
ILIITGRAKKAIEDHFDRSPELELHLEQSRKSNMLTEVQAISDLVNIHYVRQKTPLGLGH
AILCARSFVGGEPFAVLLGDDIIQSDEPVVRQLMKQYTDPERALLGVQPVPAADVSKYGI
IEPARLVVGSEPFPVKRLIEKPNEAEAPSNFAVLGRYILPPSIFDALEQTPIGHGGELQL
TDALQKLAAMGLVDAYQFEGVRHDIGNLEGWLKANLAFGLEDPKLAASMRKWLMDDRVQS
RLANY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaacatcgcagaggtgaagcatatgaaggtcagaaaggcggtcatcccggccgcg
ggatttggcacgcggatgcttccggccaccaaggccgtgcccaaagaaatgctgcccatc
ctcaacaagccttgcattcaatacatcgtggaagaagcggtgtactcgggcattgaggag
attctcatcatcaccggccgcgcgaaaaaggccatcgaggaccatttcgaccggtcgccg
gagttggaattgcacctggagcaaagccgcaagtccaacatgctcaccgaagtgcaggcc
atttccgatctcgtcaacatccactacgtgcgccagaagacgccgctcggcctcgggcac
gcgattctgtgcgcgcgatcctttgtgggtggagagccgttcgccgtgctgctcggtgac
gatatcatccagtcggatgagcccgtggtgcgccagctcatgaagcaatacacggatcca
gagcgcgccctgctcggggtgcagcccgtcccggcggccgacgtgtcgaagtacgggatc
attgagcccgctcgccttgtcgtcggatcggaaccattccccgtgaaacggctcattgag
aaaccgaacgaagccgaggcgccttcgaatttcgccgtgcttggacgatacatactgcct
ccatccatctttgatgcgctggagcagacgcccattgggcacggtggcgaactgcagctg
accgatgcccttcaaaaactcgccgcgatggggctcgtcgacgcataccaattcgagggc
gtgcggcacgacatcggcaacctcgaggggtggctcaaggcgaatctggcattcgggctg
gaggatccgaagctggccgcgtccatgcgcaagtggctgatggacgatcgcgtccagagc
cgcctggcgaactactga

DBGET integrated database retrieval system