KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2209Help
Entry
TC41_2209         CDS       T01821                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TC41_2209 (hemY)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TC41_2209 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2104447..2105865
Genome map
AA seq 472 aa AA seqDB search
MHMKRVAVVGGGITGLAACLRLLSSDAHVQIVLYEASDRLGGRVQTIREPHLGLTVEAGP
DSMLARKPAAMRLMESLGMAEDVVSTRPEATETYIVRDGGLCPMPKGYLGIPFDPSCVRP
PLLTDAGLARALEEERMPLDLPEDDTALGAFLRARLGDEWVNYVGEPLMAGIYAGDIDRL
SLMATWPSLLDLLRNHGSLVAASRALVAASSPRQPGSSRSAFITVRGGLSSVIERMVDRM
ARSGRVEIRTGARVGAVTRRGSVYRFHIDTVSGEHLEEDVDGAVFALPPQVTREIMRPMI
DLPDVETHYQSTATIVLVYERTAFGPDLVRASGFLVPRPERMAITATTWMSNKWPHVAPE
SLAVIRAYVGRRGQDEALALSDDELARRAAEEVGRLTGAREHPIWTRVTRFREAMPNYGI
GHLARVERAEVTLRASCPAFAIAGAGYRGVGLPDCVEQGERAAHQVLAAIGP
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgaaacgcgtggcagtggtgggcggtggaatcaccggtctcgcggcttgcctg
cgcctgttgtcctccgacgctcacgtgcagattgttctgtacgaggcgagcgataggctt
ggcgggcgtgtacagacgattcgcgagcctcatcttggtctgaccgtggaggcgggccca
gactccatgctcgcgcgaaagcccgccgccatgcggctgatggagtccttgggcatggcg
gaagacgtcgtgtccacgcggcccgaggcgaccgagacctacatcgtccgagacggcggc
ctctgccccatgccgaaaggatacttgggaattccgttcgatccgtcctgcgttcgcccg
cccctcttgacggacgccggattggcgcgcgccctggaggaagagcggatgccgctcgat
cttcctgaagacgacaccgccctcggcgcctttctccgtgcgaggctcggcgacgaatgg
gtgaactacgtcggcgaaccgctcatggcgggcatctacgcgggcgacattgatcgtctg
tcgctcatggccacgtggccctcgctcctcgatctcctccgcaaccatggcagcctcgtg
gcggcaagccgcgccctggtcgcggcatcgagcccgcgccaacctggctcgagccggagc
gcgttcatcaccgtgcgcggcggcctgtcgtccgtcatcgagcgcatggtggatcggatg
gcacggagcggccgggttgagatccgcaccggtgcgcgcgtcggcgcagtgactcggcgc
ggctcggtgtaccggttccatatcgatacggtctccggggagcacttggaggaagacgtg
gatggcgccgtgttcgccctcccgccacaggtcacccgcgagatcatgaggccgatgatc
gacctacccgacgtggaaacgcactaccagtcgaccgccaccatcgtgctcgtgtacgag
cgcaccgccttcggaccggatctcgtgcgagcttcgggcttcctcgtgccgaggcccgaa
agaatggccatcaccgcgaccacgtggatgtcgaacaagtggccgcacgttgcccctgag
tccctcgccgtgatccgcgcctacgtcggcaggcgcggccaggacgaagccctcgcgctg
tccgacgacgaactggcgcgtcgcgcggcggaagaagtcggacgcctcaccggtgcgcgc
gaacacccgatttggacgcgggtgacgcgctttcgggaggcgatgccgaactacggtatc
ggacacctcgcccgcgtggagcgagcagaagtgacgttgcgcgcgtcctgtcccgcattc
gccatagccggagctggctaccgcggagtcgggctgcccgactgcgtggagcagggcgaa
cgggcggcccatcaggtcctcgccgccatcggcccatga

DBGET integrated database retrieval system