KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2234Help
Entry
TC41_2234         CDS       T01821                                 

Gene name
ruvC
Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  
crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aad00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TC41_2234 (ruvC)
Enzymes [BR:aad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     TC41_2234 (ruvC)
DNA repair and recombination proteins [BR:aad03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TC41_2234 (ruvC)
    RecFOR pathway proteins
     TC41_2234 (ruvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2130999..2131553)
Genome map
AA seq 184 aa AA seqDB search
MESLRILGVDPGLARLGFGIIERGPGDSLRHVSHGCIETGADTPLPERLQHIFQQLTELC
RTYRPEVMVVEELFFSRNATTAFTVGQARGVALLAGAQAGLAVTEYTPMQVKQAVTGYGR
ADKRQVQEMVRLLLRLTSVPKPDDAADALAVAIAHAHAGRIGELEARLAAGKRTGWMWER
GRFR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtggagtccttgcgcatccttggcgtggaccccggcttggcccggctgggattcggcatc
attgagcgagggccgggtgattcgctccgccatgtgtcgcacggctgtatcgagacgggt
gcagacacgcctttgcccgagaggcttcagcatatttttcaacaactgacggagctctgc
cgaacgtatcgtcctgaggtcatggtggtggaagagctgttcttcagccgcaacgccacg
accgccttcacggtcggccaggcgcgcggcgttgccctcttggcgggcgcgcaagcgggg
cttgcggtgacggagtatacgcccatgcaggtcaagcaggcggtgacagggtacggacga
gcggacaaacggcaggttcaggagatggtgagactccttttgaggctgacgagcgtcccg
aagcccgatgacgcggccgacgcgctggcagtcgccatcgcgcatgcgcatgccggacgg
atcggcgagctggaggcgagactggccgcaggcaagcggacgggatggatgtgggaacgg
gggcgttttcggtga

DBGET integrated database retrieval system