KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2242Help
Entry
TC41_2242         CDS       T01821                                 

Definition
(GenBank) hypothetical protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YunB
Motif
Other DBs
NCBI-ProteinID: AEJ44147
UniProt: F8IFR3
Position
complement(2136418..2137020)
Genome map
AA seq 200 aa AA seqDB search
MSFTAIGLLVFWLEWRLAPMVRTASASLATRVATEALNQAMGEVLSSYPDGKDLVSIRME
RGVNGQAFSIVTLNMAKLAKLQSEAIHASETRLETLRRQTLTLPVLQALSGSILAGYTAT
VPVSFSLVGAVHARLDADVASKGVNQVVHIVYLDLTADVMTITPLVRSPVHVTARSPVVY
IVMSGPVPNVVFPGGTSATS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgagctttacggccatcggtcttttggtgttttggctggagtggaggctcgcgcctatg
gtgcgcaccgcatcggcgtcgctcgccacgcgcgtcgccaccgaagcgctgaaccaggcc
atgggagaggtgctctcatcctacccagatgggaaagatttggtcagcatccgcatggaa
cgcggcgtaaacggccaggcgttttccatcgtcacgttgaacatggcgaagctcgccaag
cttcagagtgaagccatccacgcaagcgaaacccgcctcgagacgcttcgcagacagacc
ctcacgctccccgttctccaggcgctttcggggtctatccttgcgggctacaccgccacg
gtcccagtgtctttttccctcgtcggagctgttcatgcgcgcctcgacgcggacgtggcc
tcgaaaggcgtgaatcaagtggtgcacatcgtctaccttgacctcactgccgacgtcatg
acgatcaccccgctcgtccgatcgcccgtgcatgtgacggcgagatcgcccgtcgtgtac
atcgtcatgagcggtcctgtgccgaatgtcgtctttcccggcggaaccagtgccacctcg
tag

DBGET integrated database retrieval system