KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2243Help
Entry
TC41_2243         CDS       T01821                                 

Gene name
tyrS
Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aad00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    TC41_2243 (tyrS)
Enzymes [BR:aad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     TC41_2243 (tyrS)
Amino acid related enzymes [BR:aad01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TC41_2243 (tyrS)
Transfer RNA biogenesis [BR:aad03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TC41_2243 (tyrS)
 Prokaryotic Type
    TC41_2243 (tyrS)
Mitochondrial biogenesis [BR:aad03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TC41_2243 (tyrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2137192..2138427)
Genome map
AA seq 411 aa AA seqDB search
METVLTPDQEAEVARQLAIIRRGTAEIVPEDELVQKLRESVRTGRPLRVKLGIDPTSSDI
HLGHTVVLHKLRQFQDLGHQVFLVIGSFTGQIGDPTDKAETRKQLSAEEVAENAKTYVEQ
LYKVLDPAKTQVVYNGDWLAPLDFAQVIRLASTITVARMLEREDFQKRFQDNRPIHVHEF
YPLMQAYDSVHLRADVELGGTDQKFNLLMGRHLQREFGQPMQVAVMLPLLEGLDGVHKMS
KSLGNYIGLNEEPNNMFGKLMSVPDSLLFKYYELLSLRPQDEIEAMRREVEAGRMNPRDA
KMQLAEELVERFLGPEARREAVEHWRTVFQKGGLPEDMPERRVTGEAQWIVKWLVDLGFA
QSNSDARRAIQEGAVRINGTKVTDTDMQYCPQDGDVLQRGKRQFVRLRTKG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccgtgttgactccggaccaggaggcggaagtggcacgccaactggctatcatt
cggcgcgggacggccgagatcgtcccggaggacgaattggtgcagaagctgcgggaatcc
gtgcggaccggaagaccgctgcgcgtgaagcttggcatcgatccgacatcgtccgacatt
catctggggcacaccgtggtgctgcacaagttgcgccagtttcaggaccttggtcatcag
gtgttcctcgtgattggcagcttcacgggccagattggggatcccaccgacaaggccgag
acacgcaagcaactttcggcggaagaagtggccgagaacgcgaagacgtacgtggaacag
ttgtacaaggtcctcgatccggcgaagacgcaggtcgtgtacaacggagattggctcgcg
ccgctcgatttcgcgcaggtcattcgcctcgcgtcgaccatcaccgtggcccgcatgctc
gagcgagaggattttcaaaagcgattccaggacaatcgtcccattcacgtccatgaattc
tatcccctcatgcaggcgtacgactcggttcacctgcgcgcggacgtggaactgggcgga
acggatcagaagttcaacctgctcatgggtcgccaccttcagcgcgaatttggccagccc
atgcaggtggcggtgatgttgcccctattggaggggttagacggcgtccacaagatgtcg
aagagcctcggcaactacattggcttgaatgaggagcccaacaacatgttcggcaagctg
atgtccgtgccggacagcttgttgtttaaatactatgagctgctatcgcttcggccgcag
gatgagattgaggcgatgcgcagggaggtcgaggccgggcggatgaacccgcgcgacgcc
aaaatgcagctcgccgaagagctcgtcgagcgatttcttgggccagaggcgcggcgggaa
gccgtggaacactggcgcaccgtcttccaaaaaggtggtctgccggaggacatgcccgag
cggcgggtaaccggcgaggcgcaatggattgtcaagtggctggtggacctcggctttgcc
cagtcgaacagcgacgctcgccgcgccattcaggagggcgccgttcgaatcaatgggacg
aaagtgaccgacacggatatgcagtactgcccacaggacggtgacgtccttcagcgaggc
aagcggcagtttgttcgactgcgtacgaaaggatga

DBGET integrated database retrieval system