KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2247Help
Entry
TC41_2247         CDS       T01821                                 

Definition
(GenBank) membrane protein of unknown function
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2143931..2144281
Genome map
AA seq 116 aa AA seqDB search
MNVLGHVVRFIVSALVLLFVGHIVPGFRVMGFWHAILAAIVITLLGMAMEAIFGRRISPY
GRGIIGFICGAVVIYVAQLIVPGMHASILGALLASLVIGIIDLFVPTSLRGSRHEE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgcttggccacgtcgtccgtttcattgtgtccgctctcgtgctcctgttcgtc
ggccacatcgtgcctggattccgagtgatgggattttggcacgcgattctcgccgccatc
gtcatcacgttgctcggcatggcgatggaggccatcttcggccgccgcatctcgccctac
ggccgcggcatcatcgggttcatctgcggcgcggtcgtcatttatgtcgcgcagctcatc
gtccccggcatgcatgcgagcatcctcggcgccctgctggcatcgctcgtcatcggcatc
atcgatttgttcgtgccgacgagcctgcgcggcagtcgccacgaggagtaa

DBGET integrated database retrieval system