KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2248Help
Entry
TC41_2248         CDS       T01821                                 

Definition
(GenBank) Colicin V production protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Colicin_V CAAD DUF3810
Motif
Other DBs
NCBI-ProteinID: AEJ44152
UniProt: F8IFR8
Position
complement(2144330..2144878)
Genome map
AA seq 182 aa AA seqDB search
MTWDALDVALAAVLLLGAVNGYRLGFVRQVMRLFGGVIAYLVSYWARPYVAPAIAHLGLP
SGAAPSPLASFVLGNLSGAISFAVVFLVVFLMLRYAAGLVDALFSLPVLSALNRMAGLLA
GLLLSAVFVYVIALVLPYVRTPAMERQVARSAICRAFDNRALDRSVAAWLAAVLPGKEKM
NA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtgggacgcgctcgatgtcgccctggcggcggttctcttgcttggcgcggtgaat
gggtatcgcctcggcttcgttcgacaggtgatgcggcttttcggcggcgtcatcgcgtac
ctggtgtcgtattgggctcggccgtacgtcgcccccgccatcgcccacctgggccttcct
tctggcgcggcgccgtctccgctcgcttcgttcgtattaggcaacctgtcgggcgctatt
tcgtttgccgtcgtgtttctggtcgtgttcctcatgttgcggtatgcggcggggcttgtc
gatgcgctgttcagcttgccggtgctttcggcgttgaatcggatggcaggtctcctcgcg
ggtttgctcctgtcggccgtgtttgtctatgtgatcgcgctggtgttgccgtacgtgaga
acccccgcgatggaacgacaagtggcgagatccgccatttgccgcgcgttcgacaaccgc
gctttggatcgatcggtggcggcgtggctcgcggctgtcttgcctggaaaagagaagatg
aacgcatga

DBGET integrated database retrieval system