KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2253Help
Entry
TC41_2253         CDS       T01821                                 

Gene name
purK
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase, ATPase subunit
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00230  Purine metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
Module
aad_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TC41_2253 (purK)
Enzymes [BR:aad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     TC41_2253 (purK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp Dala_Dala_lig_C ATPgrasp_Ter PALP 2-Hacid_dh_C ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AEJ44157
UniProt: F8IFS3
Position
complement(2149124..2150308)
Genome map
AA seq 394 aa AA seqDB search
MPKRPKPADAVLPPATIGILGGGQLGRMIALAGRHMGYRFRVLDPTLDAPAAQVADGQVV
AAFDDVDAARRLASQCHLVTYEFENVSAAVAAALAETCDVPQGSELLAICQHRVREKSTL
AQHGLPVTPFAPISSMGDLDGAFEQFGGRMVVKTCRGGYDGKGQWMVRSREDLERYAQDW
AQAIDHHRAAGFDDQPLIAEAYVPFEGELSVIVARNRRGEVRAFPPAENIHKRHILHMSI
VPARYPKDVIARAEDVARQVAEALGVVGLIAVEMFVAQGGEILINELAPRPHNSGHYTLD
ACATSQFEQHVRAICNLPLGDVTLYSPVVMVNVLGQHVEPLLARMSDLPSCVKVHLYGKA
EAKRDRKMGHVNIVVDEVARALQWVELSGVWADV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaagcgaccgaaacccgctgacgccgtcctgccgcctgccaccatcggcattctc
gggggtggccagttgggccggatgatcgccctcgccggtcggcacatggggtaccggttt
cgcgtgctggatccgacgttggatgcgcccgcggcccaggtcgcggacggtcaggtcgtc
gcggccttcgacgacgtggacgccgcgcggaggctcgcatcgcagtgccatctcgtcacg
tacgagtttgaaaacgtgagcgccgcagtcgccgccgcgctggcggagacctgcgacgtg
ccgcagggcagcgagctgttggcgatttgtcagcaccgcgtgcgagaaaaatcgaccctt
gcgcagcacggccttccggtcacgccctttgcgcccatttcttccatgggcgatctcgac
ggggcgttcgagcaattcggcgggcggatggtggtcaaaacgtgtcggggcgggtatgac
ggcaagggccagtggatggtccggtcgcgagaagacctggagaggtacgcgcaggactgg
gctcaggccatcgaccaccaccgagccgcgggttttgacgaccagccgctgatcgcggag
gcgtatgtgccgttcgagggcgagctgtccgtcattgttgcgcgcaaccggcgcggcgag
gttcgggcctttccgccggccgagaacattcacaagcggcatatcctgcacatgtccatc
gttccggcccggtatccgaaggacgtgatcgcgcgcgcggaagacgtcgctcggcaggtg
gcggaggcgctcggcgtcgttggcctgattgcagtggagatgttcgtggctcagggcggg
gagatcctgatcaacgaactcgcgcctcgcccgcacaactcgggtcactacacgctcgat
gcgtgcgcgacgagtcagtttgagcagcatgtgcgcgcgatatgtaacctcccgctcgga
gacgtgaccctgtattcgccggtggtgatggtcaacgtcctcggccaacatgtggaacct
ctgctcgcgcggatgagcgaccttccgtcctgtgtgaaggtgcatctgtacggcaaggcg
gaggcgaagcgggatcggaaaatgggccacgtgaatatcgtggtggatgaggtggcgcgg
gcgcttcagtgggtcgagttgtccggcgtgtgggccgacgtgtga

DBGET integrated database retrieval system