KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2255Help
Entry
TC41_2255         CDS       T01821                                 

Gene name
fbaB
Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K11645  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00010  Glycolysis / Gluconeogenesis
aad00030  Pentose phosphate pathway
aad00051  Fructose and mannose metabolism
aad00680  Methane metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
aad01230  Biosynthesis of amino acids
Module
aad_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_2255 (fbaB)
   00030 Pentose phosphate pathway
    TC41_2255 (fbaB)
   00051 Fructose and mannose metabolism
    TC41_2255 (fbaB)
  Energy metabolism
   00680 Methane metabolism
    TC41_2255 (fbaB)
Enzymes [BR:aad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TC41_2255 (fbaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: AEJ44159
UniProt: F8IFS5
Position
complement(2150818..2151885)
Genome map
AA seq 355 aa AA seqDB search
MIEKIREYLGAEADYLLNHECKTIPKERLTPPSPTMVDDVFLYSNRNNQVLRSLQWLLSS
GRLAGTGYVSILPVDQGIEHSAGASFAKNPDYFDPENIVKLAIEGGCNAVASTLGVLGLT
SRKYAHKIPYIVKLNHNELLTYPNKYDQIMFASVKQAWNLGAAGVGATIYFGSPESTRQI
QEVSEAFQLAHELGMFTVLWCYLRNPAFVKDGVDYHTAADLTGQANHLGVTIEADIVKQK
LPEVNGGYQALNMGQSSYGKIDKRVYTELTSDHPIDLARYQVANGYMGKIGLISSGGASG
ENDFAEAVRTAVINKRAGGMGLISGRKAFQRPMAEGVKLLNLIQDVYLCKDVTLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaaaaaattcgcgagtatctgggcgctgaagcggactatctgttgaatcacgag
tgcaagacgattccgaaggagcggctgacgccgccgtcgccgaccatggtggacgacgtg
ttcctgtattcgaaccgcaacaatcaggttcttcgttccttgcagtggctattgtcctcc
gggcggctcgccggcacgggctacgtgtccattctgccggtggatcagggcatcgaacat
tcggcgggcgcctcgtttgccaagaatccggactacttcgatccggaaaacatcgtcaag
ctcgccattgagggcggttgtaacgccgtggcatccacgctcggcgtgctgggcttgacc
agccgcaaatacgcccataaaattccttatattgttaaactcaatcacaacgagctgctg
acctatccgaacaagtacgatcagatcatgtttgcgtcggtcaagcaggcgtggaatctc
ggcgccgcgggcgtgggggccaccatttacttcggctcgcccgagtcgacgcgccagatc
caggaggtcagcgaggcgttccagctggcgcacgagctgggcatgttcacggtgctctgg
tgttatctccgcaatcccgcgtttgtcaaagacggcgtcgattatcacacggcggctgac
ctgacgggccaggccaaccacctgggcgtgaccatcgaagcggacattgtgaagcagaag
cttcccgaggtgaacggcggctatcaggcgctgaatatgggccagtcgagctacggcaag
atcgacaagcgcgtgtacacggaactcacgagcgaccatcccatcgatctcgcgcgctat
caggtggcgaacggctacatgggcaagattggcctcatcagctccggcggcgcctcgggg
gaaaacgacttcgccgaggccgtgcgcacggccgtcatcaacaagcgcgcgggcggcatg
gggctcatttccggacgcaaggcgttccagcgcccgatggcggaaggcgtgaagctgctg
aatctcattcaggacgtgtatctgtgcaaggacgtcacccttgcctga

DBGET integrated database retrieval system