KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2258Help
Entry
TC41_2258         CDS       T01821                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  
methyl-accepting chemotaxis protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aad00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TC41_2258
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TC41_2258
Bacterial motility proteins [BR:aad02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    TC41_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2155828..2157594)
Genome map
AA seq 588 aa AA seqDB search
MSTYDDIPARADTRLRKLGQRFVDLLPTLNIRQKFLVNTGLVTLLLVALGVVNGILVSQL
HQSVRKLEQADTVLNLIRQFDDDIVTADNDAALYLLTPNGDNAQFNLQDYQNDLARVQQD
LSVLQREPVNATDKAILDLFQSEWQQILDQNETAFRLASTSLSDAQAMFTNNTLQPLIQS
LSEFTQDEQAVKNAAAANVNRLLVQTFVWSTVVALVAIAIGLAGSATLAITISGPIVRLR
QMALRVSQGDLRVRPVEARTRDEIEDLARVWNDLVGNLRALIGAIAGASEHVATSAEELS
ASSDELMRTTTEIARSIEQVAAGAEEQMKQIEDTSSAVSQVQAEIGKVSRLAEGLHQTAE
RTDGEAEAGTQVMDAMARQMEAIRQRATDAAEVMRKTAEASESVRQIVAAIMHIADETNL
LALNAAIEAARAGDHGRGFAVVAEEVRSLSKASADAAREIHGIVDRVVRSMNEVAQSIQA
VTAEVDAGASVADETKRTFARIRTSMAEVASGAEEVAEATKTIVAQADHMSSDMAVVVEL
AQQAARESESVVAASQQQASSMQEIASTAASLSSRAQDLQSLIGRFLI
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctatgacgacatcccagcgcgcgcagacacgcgccttcgcaagctcggtcag
cggttcgtggatctgttgccgacgctgaacattcgtcaaaagttcctcgtcaataccggc
ctcgtgaccctccttctcgtcgccctcggcgtcgtgaacggcatcctggtcagccaactg
caccagtcggttcgaaagctcgagcaggcggacacggtgctaaacctcattcggcagttt
gatgacgacatcgtgaccgcggacaacgacgcggcgctttatctgctcacgccgaacggc
gacaacgcccagttcaaccttcaggattaccagaacgatctcgcgcgcgtgcaacaggat
ctgagcgtcttgcagcgcgaacccgtcaatgccaccgacaaggccatcctcgacctgttc
cagtcggagtggcagcagatcttggatcaaaatgagaccgctttccgcctagcgtcgacg
agcctgtccgacgcgcaggcgatgttcaccaacaacacgctgcagcccttgatccagagc
ctgtcggagttcacacaggacgagcaggcggtcaaaaacgcggccgccgcgaacgtcaat
cgcctgctcgtgcagaccttcgtctggagcacggtcgtggcgctggtcgccatcgccata
ggtctcgccggcagtgcgacgctcgccatcacgatatcgggccccatcgtgcggctccgc
cagatggcgctcagagtgtcgcagggcgacctgcgcgtccggcccgtcgaagcgcgcaca
cgcgatgagatcgaagatctcgcgcgcgtctggaacgacctcgtcggcaatctcagggcg
ctcatcggcgccatcgcgggcgcttctgaacacgtggcgacgagcgccgaagagctatcg
gcgagttcggacgaactgatgcgcacgacgaccgagatcgcgcggtccatcgagcaggtg
gcggctggcgccgaggaacagatgaaacagattgaggacacgtcaagcgccgtgtcccag
gttcaggccgagatcggcaaggtgtcgcgcctcgcagaaggtctgcatcagaccgctgag
cggaccgatggcgaagcggaggcgggaacgcaggtcatggacgcgatggcgcgccagatg
gaggccatccggcaacgcgccaccgatgctgcggaggtcatgcgtaagacggcggaggct
tcggaaagcgttcggcagattgttgcggccatcatgcacatcgccgacgagaccaacctc
ttggcgctgaacgcggccatcgaggccgcccgcgcgggcgatcacggccgcgggtttgcc
gtcgtagccgaggaggtcaggagcctgtccaaggcgtccgccgacgcggcgcgcgagatt
cacggcattgtcgatcgcgtcgttcgctccatgaacgaggtggcccaatccattcaggcg
gtcaccgcggaagtggacgccggcgcgtccgttgccgacgagacgaagcggacgttcgcg
cgaatcaggacctccatggcggaagtggcatcaggcgccgaagaggttgcagaagccacc
aaaaccatcgtcgcccaggcggatcacatgtcgagcgacatggccgtggtggtggaactg
gcgcaacaggccgcccgcgagtcggagagcgtggtggccgcttctcagcaacaagcgagt
tcgatgcaggaaattgcatctactgctgcatcactcagttcgcgagcacaggatcttcaa
tctctcatcggccgttttctgatctag

DBGET integrated database retrieval system