KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2265Help
Entry
TC41_2265         CDS       T01821                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00020  Citrate cycle (TCA cycle)
aad00310  Lysine degradation
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
aad01200  Carbon metabolism
Module
aad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TC41_2265 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    TC41_2265 (sucB)
Enzymes [BR:aad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TC41_2265 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_3 E3_binding TFIIA
Motif
Other DBs
NCBI-ProteinID: AEJ44168
UniProt: F8IFT4
Position
complement(2163811..2165070)
Genome map
AA seq 419 aa AA seqDB search
MAEVKVPSLGESIVEATIGQWLKREGDAVESGEAIAELETDKVNVEVIAEESGVLAQILK
QVGDTVAIGDVIAVIAEGQAPSAPASESAPAAQAQEVKPSAPSAPQVQPQAPSASSAPSS
AQPQVSVPGELLVRPTPSLRRAAAAQGIDLRQVQAGALGLGAQPSAPAAPQATSAPSAQP
ATPSALRPDEERIRMSRRRATIAKRLVEAQHTAAMLTTFNEVDMSRVIEIRKRRKDAFRE
KYGVGLGYMSFFTKAVVGALKQFPLLNAEIQGEDMIVKHHYDIGIAVATEGGLVVPVVRN
ADRLTFAEIEQQIADLAARARANKLTLEELQGGTFTITNGGTFGSLFSTPILNAPQVGIL
GMHNIVERPVAVNGQVEIRPMMYIALSYDHRIVDGAEAVSFLVTVKRLIEDPESLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaggtcaaggttccatcgctaggcgagtcgattgtggaagcgacgattggacag
tggctcaagcgcgaaggggatgcggttgagtcgggcgaggctatcgcggaactggagacg
gacaaggtcaacgtggaggtcatagcggaggagtcgggtgtcctggcgcagatcctcaag
caggtcggggataccgtggcgataggggatgtcattgctgtgattgcggagggccaggcg
ccgtctgcgcctgcctcggagtcggctccggcagcgcaggcgcaggaggtcaagccgtcg
gcgccgagcgctccgcaggtgcaaccacaggcgccgtccgcgtcatctgcgccatcctcg
gcgcagcctcaggtctccgtgccgggcgaacttctggtgcgcccgacgccgtcgctgcgg
cgggctgcggccgcgcaggggattgatctccgtcaggtgcaggccggcgctttgggcctg
ggcgcccaaccatcggcacctgcggcgcctcaggcgacttccgctccgagcgctcagccc
gcgacaccgtcggcgctgcgcccggatgaggaacggatcaggatgtcgcgtcgccgcgcg
actatcgcgaagcgcctggtggaggcgcagcacaccgcggccatgctgacgacgttcaac
gaagtggacatgagccgggtcatcgagatccgcaagcggcgcaaggacgcgttccgcgag
aagtacggcgtggggcttggctacatgtcgttcttcacgaaggcggtcgtgggcgcgctg
aagcagttcccgctcctgaacgcggagattcagggcgaggacatgattgtgaaacaccac
tacgacattggcatcgcggtggcgacggagggcggcctcgtcgtgccggtggttcggaac
gcggatcgcctgacgtttgccgagatcgagcagcagattgccgatctcgccgcgcgcgct
cgcgcgaacaagctgacgctcgaggagttgcagggtgggaccttcaccatcacgaacggc
ggcacgtttggctcgctgttctcgacgccgattctgaacgcgccccaggtcggcatcctt
gggatgcacaacatcgtagagcgcccggtggcggtgaatgggcaggtcgagatccgcccg
atgatgtacatcgcgctttcgtacgatcaccgcattgtcgacggggccgaggctgtgagc
ttcttggtgaccgtgaagcggctgatcgaggatcccgagtccctgttgctcgaaggctga

DBGET integrated database retrieval system