KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2268Help
Entry
TC41_2268         CDS       T01821                                 

Gene name
moxR
Definition
(GenBank) ATPase associated with various cellular activities AAA_3
  KO
K03924  
MoxR-like ATPase [EC:3.6.3.-]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
Enzymes [BR:aad01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     TC41_2268 (moxR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2169371..2170354
Genome map
AA seq 327 aa AA seqDB search
MHETWTSESVAQAKPDLDAVIREVCHCVVGQDQAVKLLVAACLAGGHALLEDVPGTGKTK
LASSLAAALGLSFARVQGTPDLLPADVIGTTVYHPREEAFRFHPGPIFTQVLLFDEINRA
TPRTQSALLQAMAERAVTVDGEERPLPRPFFVLATANPVESQGVFPLPEAELDRFLVQVS
LGYLPESLEIEMVKRVMAEGADGPAPAPVLGADRLVKLQHMTQRVFVHDDVVRYAVSLAR
RTRDHDQISLGASPRSAVWLVRLSQALALLAGRHFVTPDDVQEAFVPVMRHRLVYDIAWA
DRGERDRLLESILGDTPVPHEREVSSP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagacgtggacgtcggaatcggtcgcgcaggcaaagccggacctcgacgccgtc
atccgagaagtgtgccattgcgtcgtgggccaagatcaggccgtgaagttgctcgtcgcc
gcgtgccttgccggaggccacgcgctccttgaagacgtacccggaacaggcaagacaaaa
ctcgcctcctccctcgctgctgcgctcgggctgtcgttcgcccgggtgcagggtacgccg
gatctcctccccgcggacgtcatcggaaccacggtgtaccatccgcgcgaggaggcgttc
cggttccacccgggtcccatcttcacgcaagtcctgttgtttgacgagatcaaccgggcc
actccccgtacgcagtcggcgcttcttcaggcgatggccgaacgcgcggtgaccgtcgac
ggcgaagagagacccctgccgcggccgttctttgtcctcgcgaccgcgaatcccgtcgag
tcgcagggcgtcttccccctccccgaggcggaactcgaccggttcctcgtgcaggtatcc
ctcgggtatctgccggaatccctcgagattgagatggtcaagcgcgtcatggccgaaggg
gcggacggccctgccccggcccccgtccttggcgccgaccggcttgtcaagctgcaacac
atgacccagagggtcttcgtgcacgacgacgtggtgcgctacgccgtatcgctcgccagg
cgcacgcgcgatcacgaccaaatctccctcggtgcaagccctcggtcggctgtgtggctc
gtgcggctctcgcaggcgctcgccctcctcgcggggcggcacttcgtcactcccgacgac
gttcaagaggcgtttgttcctgtgatgcgccaccgactcgtgtatgacatcgcgtgggcg
gatcgcggggagcgagatcgtctcctcgaatccatcctcggcgacacgccggtgccgcac
gaacgcgaagtgagttcgccgtga

DBGET integrated database retrieval system