KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2305Help
Entry
TC41_2305         CDS       T01821                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aad00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aad00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2201673..2203001)
Genome map
AA seq 442 aa AA seqDB search
MMDVATYFPEVTRIAYEGKGSDNPLCFKYYNPEETVLGKPMKEHLRFSVAYWHTFTLSGA
DPFGLPNMIRPWDGATGMDLAKRRVEAAFEFMTKLGVEYFCFHDRDIAPEGDTLRETNRN
LDEIVALIKEYMQSTGIKLLWNTQNLFSNPRFAHGAATAPDADVFAYAAAQVKKSLEIAK
ELGAENYVFWGGREGYETLLNTDLKLELDNYARLLQMAVDYADEIGFTGQFLIEPKPKEP
TKHQYDFDVQSGLAFLYHYGLKDRFKFNIEANHATLAGHTFQHELRFARINGLLGSVDAN
QGDPLLGWDTDEFPTNLYETTLAMYEILLNGGLAPGGLNFDAKVRRASMTPIDLFYGHIA
GMDSFARGLKVAAKLLEDRVFEREIEERYESYRAGIGKDIVEGRATLQTLESYVLDKRVT
ATRSGRQEVLLAKLNQYLLETE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgatggacgtggcgacgtattttcccgaagtgacgcgcatcgcatacgaaggcaaggga
tccgacaatccgctctgcttcaagtactacaaccccgaagagacagtgttgggaaagccg
atgaaggaacatctccgcttctcggtggcctactggcacacgttcacgctgtccggcgcg
gatccgttcggattgccgaacatgatccggccgtgggacggggcgacggggatggatctg
gccaagcgccgcgtggaggcggcgttcgagttcatgaccaagctcggcgtcgagtacttc
tgtttccacgatcgcgacattgcgcccgagggtgacaccttgcgcgagaccaatcgcaat
ctggacgagatcgtcgcgctcatcaaggaatacatgcagtcgacgggcatcaagctcctg
tggaatacgcagaacctgttctcgaatccaaggtttgcgcatggcgccgcgacggctccg
gacgcggacgtattcgcgtacgctgccgcgcaggtgaagaagagcctggaaattgcgaag
gagctcggggcggaaaactacgtgttctggggcggccgcgagggctacgagacgctcctc
aacacggatctcaagcttgagctcgacaattacgcgcgccttctgcagatggcggtggac
tacgcggacgagatcggcttcaccgggcaattcctgattgagccgaagccgaaggagccc
acgaagcaccagtatgacttcgacgttcagtcggggctcgcgttcctctatcattacggg
ctcaaggaccgcttcaagttcaacatcgaggcgaatcacgccacgctcgcgggccacacg
ttccaacacgaacttcgcttcgcccggatcaacggccttcttgggtctgtcgacgcgaac
cagggcgatccgctgctcggctgggacacggacgagtttccgaccaacctgtacgagacg
acgctcgcgatgtacgagatcctcctgaatggcggactggcgccgggcggcctcaacttt
gacgccaaggttcgccgcgcgtcgatgacgcccatcgatttgttctatggccacatcgcc
ggaatggacagcttcgcgcgcgggctcaaggtggcggctaaactgcttgaggaccgcgtg
ttcgagcgggaaattgaggagcgatacgagagctatcgggccggcatcgggaaagacatt
gtggaagggcgcgcgaccctgcaaacccttgagtcttacgtgctggataagcgcgtgacg
gcgacgcgatccggccgccaggaggtccttttggcgaaattgaatcagtatctgctggaa
acggaatga

DBGET integrated database retrieval system