KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2309Help
Entry
TC41_2309         CDS       T01821                                 

Gene name
ybgC
Definition
(GenBank) thioesterase superfamily protein
  KO
K07107  
acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
Enzymes [BR:aad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     TC41_2309 (ybgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2206646..2207089)
Genome map
AA seq 147 aa AA seqDB search
MPERVVTTLEVRWGECDPAGIVYHPSYIDWFSIARMHFLKENGIHYMNDFHDRGVTVVVT
DVACHYQKALRAEDTAHVTARLVEMSRARLAFRYEVTDGAGDLCAWGETRHAFVDRDTLR
PVNLAKFAPELWGRVADLPVTSGDSTA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcgcgtcgtcaccaccctagaagtccgctggggagagtgcgatccggctggg
atcgtgtatcacccgtcgtacattgactggttctccatcgctcgcatgcactttttaaag
gaaaacggcatccactacatgaacgactttcacgatcgcggggtcacggtcgtcgtgacg
gatgtcgcgtgccactatcaaaaggcgttgcgcgctgaggatacagcgcacgtgaccgcg
aggcttgtggagatgagccgagcgcggctcgctttccgctacgaggtcacagatggggcg
ggcgacttgtgcgcgtggggagagactcggcacgcgtttgtcgatcgagacacgttgcgt
ccggtgaatctcgcgaagtttgcgccggaactctggggtcgcgtagcggacctgccggtc
acgtcaggggattcgacggcgtga

DBGET integrated database retrieval system