KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2350Help
Entry
TC41_2350         CDS       T01821                                 

Gene name
leuD
Definition
(GenBank) 3-isopropylmalate dehydratase, small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00290  Valine, leucine and isoleucine biosynthesis
aad00660  C5-Branched dibasic acid metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01210  2-Oxocarboxylic acid metabolism
aad01230  Biosynthesis of amino acids
Module
aad_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    TC41_2350 (leuD)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    TC41_2350 (leuD)
Enzymes [BR:aad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     TC41_2350 (leuD)
    4.2.1.35  (R)-2-methylmalate dehydratase
     TC41_2350 (leuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: AEJ44251
UniProt: F8IGH1
Position
complement(2240721..2241329)
Genome map
AA seq 202 aa AA seqDB search
MEPLVKHEGLVVCMNRVNVDTDQIIPKQFLKRIERDGFGEFLFFDWRYLPDGSPNPDFEL
NRPEAQGATILLVDDNFGCGSSREHAVWALRDYGFRVILAPSFADIFYNNCFKNGLLPIR
IPRELYKQLSESHARGEWRRMTVDLEQQTAATDHGVTFSFEIDPHKRHMLLHGLDDIGIT
LQYEAEIAAYEASRRPYQFVYA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttggtcaagcacgaaggcctcgtggtctgcatgaaccgcgtcaacgtggat
acggatcaaattatcccgaagcagttcctcaagcggatcgagcgcgatgggttcggcgag
ttcctgtttttcgattggcggtacctgccggatggatcgcccaatcccgacttcgagctg
aatcggccggaagcccaaggcgcgaccatcctgctcgtcgacgacaacttcggctgcgga
tcttctcgcgaacacgcggtatgggcgctgcgcgactacgggtttcgggtcatcctcgcc
ccgtcgttcgctgacatcttctacaacaactgcttcaagaatgggcttctgcccattcgc
attccgcgcgagctatataaacaactctcggagtcgcacgcgcgcggcgaatggcggcgg
atgacggtggatctcgagcagcagacggccgcgaccgatcacggcgtgaccttttccttc
gagatcgatccgcacaagcggcacatgctgctccatgggctcgacgacatcggcatcacg
cttcaatacgaggccgagatcgccgcgtacgaggcttcgcgccgtccgtatcagttcgtc
tacgcgtaa

DBGET integrated database retrieval system