KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2360Help
Entry
TC41_2360         CDS       T01821                                 

Gene name
scrK
Definition
(GenBank) PfkB domain protein
  KO
K00847  fructokinase [EC:2.7.1.4]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00051  Fructose and mannose metabolism
aad00500  Starch and sucrose metabolism
aad00520  Amino sugar and nucleotide sugar metabolism
aad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TC41_2360 (scrK)
   00500 Starch and sucrose metabolism
    TC41_2360 (scrK)
   00520 Amino sugar and nucleotide sugar metabolism
    TC41_2360 (scrK)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.4  fructokinase
     TC41_2360 (scrK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AEJ44260
UniProt: F8IGI0
Position
complement(2251729..2252688)
Genome map
AA seq 319 aa AA seqDB search
MYDVLAIGEVLIDFSVVTSTDVPQMFGSAGGAPANVLAAVAKLGGRCRMVAGVGDDAFGD
FVCRVLKAVGIDDSGVVRVGTRTTLAFVHIAPDGERSFSFDRHPGADTKLRPEHLQSEWF
EQTKLVHLGSLALSDEPARSAAHHALDLARHSHRVVTFDVNYRPALWPDPREAVEQSLRV
IGLADVVKCSEEELRLLTGRHNPEEALLELTHAFPGTRFLGTLGRAGSLAVIQGECRHIP
SIPVQAVDTTAAGDAFFGALLYQMTNDADPEAVRKRLQDDAFWLSALHFANVAGALTASR
RGAIDALPTLSDILEHMPA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgtattggccattggtgaagtgttgattgactttagcgtggtgacgtcgaca
gacgtaccgcagatgttcggctcggcaggcggcgcgcccgcgaacgtgctcgcggccgtg
gcgaagctcggtggtcgatgcagaatggtggcaggcgtgggagacgatgcgttcggcgac
ttcgtttgccgcgtgctcaaggccgtcggcatcgacgacagtggcgtggtacgcgttggg
acccggactacgctggcgtttgttcacatcgcaccagacggcgagcgctcgttttcgttc
gatcgccatccaggcgcagacactaagcttcggcccgaacatctgcagtccgagtggttc
gagcagacgaaattggtgcacctcggatcgctcgcgctttctgacgaacctgcccgttcc
gctgcccaccatgcgctcgatctcgcccgccattcccatcgcgtggtgaccttcgatgtg
aattaccgtcctgccctgtggccggaccctcgcgaagcggtggagcagtcgctccgcgtc
attggcctcgcggatgtggtgaaatgctcagaggaagaactgcgcttgctcaccggacga
cacaacccggaagaagctctccttgagttgacccacgcgtttcccggaacgcggttcttg
ggtaccctcggccgggccgggtccctcgcggtcatccaaggcgaatgccgccatatccct
tccattcccgtccaggccgtggacacgaccgccgcgggcgacgcgttctttggtgctctc
ctctaccaaatgacaaacgacgcggatcccgaggcggtccgaaagcgcctccaggacgat
gcgttctggctttccgcgcttcattttgccaatgtcgcgggcgcactgacggcctctcgc
cgtggcgccatcgacgcccttccgaccctttccgacattttggaacatatgcctgcttga

DBGET integrated database retrieval system