KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2361Help
Entry
TC41_2361         CDS       T01821                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02026  multiple sugar transport system permease protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Module
aad_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:aad02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    TC41_2361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEJ44261
UniProt: F8IGI1
Position
complement(2252731..2253342)
Genome map
AA seq 203 aa AA seqDB search
MIVSITSTFFVLLFGSMAGFAIARLPMKGKQPMLIFLLIISVFPPLVVITPLYMLLRDVG
WLDSYQALVIPYTAFNLPFAIWILRNYFLQVPGALFEAAKMDGASVFMSYWRIFLPLTTP
GLFTAAVFTFVACWTEFFMALVFNPDNTMRTIPVGIALFSGQYTVPYGTIFAGSVVSIVP
IVILVVIFRRWIVSGLTQGAVKG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtctccatcacatcgacgttcttcgtgcttctgttcggatccatggcgggcttt
gccattgctcggcttcccatgaaagggaagcagccgatgctcatctttctgctcatcatc
tcagtatttcctccgctcgtcgtcattacgccgctgtacatgttgttgcgagacgtggga
tggctcgattcctatcaggcgctcgtcatcccctacacagcgttcaacttgccattcgcc
atttggattctccgcaactactttctgcaggtgccaggcgccttgtttgaagcggccaag
atggacggagcatcggtgttcatgtcgtattggcgcatcttcctgccgctcaccacgccg
gggctctttacggcagcggtgttcacgttcgtcgcctgctggacggagtttttcatggcg
ctcgtgttcaaccctgacaacactatgcgcaccattccggttgggattgcgctattcagc
gggcagtacacggttccgtacggcaccatcttcgcgggttccgtcgtgtcgattgttccc
atcgtcattctcgtggtcatcttccgccgctggattgtctcggggttgacgcagggcgcg
gtcaaaggctaa

DBGET integrated database retrieval system