KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2362Help
Entry
TC41_2362         CDS       T01821                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tmemb_9 2TM
Motif
Other DBs
NCBI-ProteinID: AEJ44262
UniProt: F8IGI2
Position
complement(2253389..2253562)
Genome map
AA seq 57 aa AA seqDB search
MRKPLYQRVIGYVVLIFFLVVILLPFYWMFVTSFEPQFRHQRLPASVLPASLDACSL
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagccattgtatcagcgcgtcatcggctatgtcgtgctcatattctttctcgtg
gtgatcctgctcccattctattggatgtttgtgacgtcgttcgagccccaattccgacat
cagcgcttacccgccagcgtacttcccgcatcactggacgcttgctcattatga

DBGET integrated database retrieval system