KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2366Help
Entry
TC41_2366         CDS       T01821                                 

Definition
(GenBank) transcriptional regulator of molybdate metabolism, XRE family
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like HTH_3 HTH_31 HTH_19 LysR_substrate HTH_26 HTH_25 Phosphonate-bd HTH_24 RHH_1
Motif
Other DBs
NCBI-ProteinID: AEJ44266
UniProt: F8IGI6
Position
2257257..2258372
Genome map
AA seq 371 aa AA seqDB search
MVKMSYLEIILSRQAIRMKFPNAVRLLREMAGLSRSELARRAGITPQALGLIEQGKVSPS
THVALRLAKALGTTVESLFDPEQKAAHHAGAGSLRTERVALAEIAGVRVARSLEDSAQPV
PSDGLRDESGCTDWITTFDGWMARVFLSGCDPALSLLAAWVNRRCRACEAVHFLSTNEGA
MAELKLGQTHIASVHGTSDAVRSLAKGKDWVIVPLAQWRMGWIVPRHNPKRWMVETGFRE
ARPRIVNRPRGAGARALVDEALRREGVSPDDICGYDVVAKTHHEVVRAVAFGGADVGIAH
EAAATPEVAFLPIREEITWLVVPRANLHHPGVQQVLDVLQSDRFRRDLSAFGPYDVSVTG
ARMSVLSKRGT
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaatgagctatcttgaaattatcctttcaaggcaggcgatccgcatgaaattc
ccgaatgccgtgaggcttctgcgcgagatggccgggctcagtcgatccgaactcgcccga
cgcgcagggatcacgccacaagcattgggcctcattgaacaggggaaagtgagtccttcg
acgcacgtcgccttacgcctggccaaagcgctcggcaccacggtggagtcgctttttgat
ccggaacaaaaggcggcgcaccacgctggcgcgggtagcttgcgcacagaacgcgtggcg
ctcgcggaaattgcgggcgtgcgcgtggcgagatcgctcgaggactcggctcaacctgtt
ccttccgacggcctacgcgacgagagtggatgcacggactggatcacgacgttcgacggt
tggatggcgcgcgtctttctgtcgggatgtgacccagcgctctcgctgctggccgcctgg
gtgaatcgccgatgccgcgcgtgcgaagcggtccactttctctcgaccaacgagggcgcg
atggcggaacttaagctagggcagacgcacattgcgagcgtccacgggacgagcgacgcc
gtccgctcgctcgcgaaaggaaaggattgggtcattgtaccgttggcgcaatggcgcatg
ggctggatagtccctcgtcacaatcccaagcgctggatggtggagactgggtttcgggag
gcgcgtccgcgcatcgtcaaccgcccccgcggagccggtgcccgcgcgctggtggacgag
gcacttcgtcgagagggcgtttctccggatgatatctgcggctatgacgtggtggcgaag
acgcaccatgaggtagtgcgggcggtggcgtttggcggcgcagatgtcggcatcgcgcac
gaggccgccgcgacgcccgaagtcgcctttctgcccattcgcgaagaaatcacctggctc
gtcgttccgcgcgccaacctccatcatcctggcgtgcagcaggtgctcgatgtactgcag
tcggatcggttccgccgcgatctctcggcctttggcccgtacgacgtctccgtgacgggc
gcccgaatgagtgtactgtcgaaacgcgggacctag

DBGET integrated database retrieval system