KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2374Help
Entry
TC41_2374         CDS       T01821                                 

Definition
(GenBank) hypothetical protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEJ44274
UniProt: F8IGJ4
Position
2262464..2262775
Genome map
AA seq 103 aa AA seqDB search
MTLRELTLVEIDALWHAADKSGYPPEVVQSAYASMICGVGLRNNESTCLATGTGRRPNVC
PFRWPRFRYGLPERLIETTIPWLLQFTARLHQQHLEYLERKRT
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgactctgcgcgaactcaccctcgtcgaaatcgacgcgctctggcacgccgccgacaag
tccggctatcctccggaggtcgtgcagtccgcatacgcatccatgatctgcggcgtcggc
ctccgcaacaacgaatccacttgcctggcgactggcactggccgcaggcccaacgtgtgc
cccttccgttggccgcgcttccgatacggtttgcccgagcgcctgattgagacgaccatc
ccctggctactccaattcaccgcccgactgcatcagcaacacttggagtatcttgagcga
aagcgcacctga

DBGET integrated database retrieval system