KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2379Help
Entry
TC41_2379         CDS       T01821                                 

Definition
(GenBank) AIG2 family protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGACT AIG2_2
Motif
Other DBs
NCBI-ProteinID: AEJ44279
UniProt: F8IGJ9
Position
complement(2264427..2264828)
Genome map
AA seq 133 aa AA seqDB search
MLCEDAILFGHRLTFNGYSAHRNGGVANIVPARGQTVHGVLWYVPDHEAKRLDRREGAPH
VYHRNLVLVRCCGMWEEAVTYQLVHPLPYEIAPSDEYARIVLSGIVNPNYRKKVEKHIAN
LQKEAFFDETIGF
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcgaggacgcaattttgttcgggcatcggctcacattcaacgggtattcggca
catcgaaatggcggcgtggcgaacatcgtcccagcgcgagggcaaacggttcacggggtg
ctgtggtacgtgccggaccacgaggcgaagcggctcgaccgccgcgaaggcgcgccgcat
gtctatcaccgcaatctcgtattggtgcgctgctgtggcatgtgggaagaggcggtgacg
tatcagcttgtccatccgctgccatacgaaatcgcaccaagtgacgagtacgcgcgaatt
gtactcagcgggatcgtcaatccgaactaccgcaaaaaggtagaaaagcatattgccaat
ctgcaaaaggaggcgttttttgatgaaaccattggattctag

DBGET integrated database retrieval system