KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2380Help
Entry
TC41_2380         CDS       T01821                                 

Definition
(GenBank) hypothetical protein
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidoligase_2 SWIM
Motif
Other DBs
NCBI-ProteinID: AEJ44280
UniProt: F8IGK0
Position
complement(2264986..2266560)
Genome map
AA seq 524 aa AA seqDB search
MAEFIAAISAQTAERIRQSWARRRDEMVGVNEMAIANAKARFLARIRRQPTVPTYSGMIA
DQFSRTRQQEEVLEFYQFADAAVQVHSESGREYVLTTDRTGTVAVACSCPDCQHRHRVCR
HMEGYNRFAAERRMAEQSEAERQRVAEAMRTETGADVPLETTNRITGAPTILTHIVDGEV
AWDNERDRALYAWHELHRHDGVYMSQDDVRWQALRESATTLEGLGEYETEHVLDGSGLAF
GLELEVDDVSGDRVAHELHALGLSAHRYVQSYSTRVGEGDGWTVKRDGSVPYGCEIVSPP
LTDTPETWAAIHEITRIVKQHGGRASRHTGLHIHMGNTILDDRGYRWQRLARYIYWFGPE
YYQMGAANEREGVTTHRGLGYAAPLQVAHIRKLRRNDNAMEASRKLIGYRGHDSRYKIIN
TAKFVESNIPTVEFRYPNGSVDPIMIQRQVQLANATMMQAAYLRRHMPGAERLPALFRGD
QSDTLAQDSEGRFRQFLDTLGSERLRRIATSLWVRGEIPASYRQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagttcattgctgcgatctccgcgcagactgccgagcgcattcgtcagtcgtgg
gcgcgtcgtcgcgacgaaatggtcggcgtgaacgagatggcaatcgcgaacgccaaggcc
cggtttctcgcgcgcattcgtcgacagccgacggtgccgacgtacagtggcatgatcgcc
gatcagttttcgcgcacccgacagcaggaagaggttctcgaattctatcagtttgccgac
gcggcggtccaggtgcactccgaatcggggcgcgagtatgtgttgaccaccgatcgaacg
gggactgttgccgtcgcgtgctcctgtccggattgccagcatcgtcatcgtgtctgccgg
cacatggagggctacaatcgtttcgccgccgaacgccggatggccgagcagtccgaagcc
gagcgtcagcgcgtggcggaggcgatgcgaaccgagacgggtgccgatgtgccactggag
accacgaaccgcataacaggcgcgccgacgatactgacccacatcgtcgacggcgaggtc
gcgtgggacaacgagcgcgaccgtgcgctctacgcctggcacgagctgcaccgccacgac
ggcgtgtacatgagccaggacgatgtgcggtggcaggcgctgcgggagtccgcgacgaca
ttagagggcctgggcgagtacgagacggagcatgtgctggacggttccggcctggcattt
ggactggagctcgaagtggacgacgtaagcggtgatcgtgtcgcacacgaattacacgcg
cttgggttgtctgcacaccgctatgtacaaagctactccacccgtgtgggtgaaggggat
gggtggacggtcaaacgcgatggcagtgtgccgtatggttgtgaaatcgtctctccccca
ttaacggatacaccagaaacctgggcagcgattcatgagatcactcgcattgtgaaacag
catggtggccgcgcttcgcgacacacgggactgcacatccatatgggcaataccatcctc
gacgatcgtggctatcggtggcaacgactggctcggtacatctactggttcgggccggaa
tactaccagatgggagcggccaatgaacgcgaaggcgtgacgacgcaccgagggctgggg
tatgccgcgccgttgcaggtggcgcacatccgcaaactccgccgcaacgacaacgcgatg
gaggcgtcccgaaagttgatcgggtacagaggccacgattctcgctacaagatcatcaat
acggcgaagttcgtggagtcgaacatccccaccgtcgagttccgctacccgaatgggagc
gttgacccgatcatgatccagcgtcaggttcaactcgcaaacgcgacgatgatgcaagca
gcctaccttcgtcggcacatgccgggtgctgaacgtctgccagcgctctttcgaggcgac
cagtcggacaccttggctcaagactccgaaggtcgattccgccagttcctcgacacgctc
ggcagtgagcgcctgcgtcgcatcgcgacgagcctctgggtgcgcggcgagatcccggcg
tcctatcgacagtag

DBGET integrated database retrieval system